Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PA04

Protein Details
Accession A0A1E3PA04    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSKSKNHTNHNQTRKAHRNGIKKPKTHydrophilic
NLS Segment(s)
PositionSequence
14-56RKAHRNGIKKPKTHRYPSLKGVDPKFRRNHKHALHGTAKALAA
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQTRKAHRNGIKKPKTHRYPSLKGVDPKFRRNHKHALHGTAKALAAARAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.77
4 0.75
5 0.75
6 0.76
7 0.82
8 0.79
9 0.76
10 0.77
11 0.78
12 0.79
13 0.75
14 0.75
15 0.73
16 0.71
17 0.72
18 0.7
19 0.64
20 0.61
21 0.59
22 0.59
23 0.55
24 0.57
25 0.58
26 0.61
27 0.63
28 0.64
29 0.7
30 0.65
31 0.71
32 0.68
33 0.68
34 0.65
35 0.6
36 0.55
37 0.48
38 0.42
39 0.33
40 0.28
41 0.21