Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P9K8

Protein Details
Accession A0A1E3P9K8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
124-145SGGAKKNKRAHFRQYMNRDKGFHydrophilic
NLS Segment(s)
PositionSequence
126-157GAKKNKRAHFRQYMNRDKGFNRNLSPERRKKK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MRDSKVDDKAKIRSRRDSASPSGRKVDSSNYRDRSRDRSYDRSSIVSNGNQTRIEDQRNTRQTDEENKIDSKDLKNEEERGRTTDRKSDSKEASDDGQQDMMMQLMGFGSFDSTKGKHVAGVGSGGAKKNKRAHFRQYMNRDKGFNRNLSPERRKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.7
4 0.68
5 0.67
6 0.68
7 0.68
8 0.62
9 0.62
10 0.56
11 0.51
12 0.46
13 0.47
14 0.46
15 0.46
16 0.52
17 0.52
18 0.56
19 0.58
20 0.6
21 0.58
22 0.56
23 0.58
24 0.56
25 0.59
26 0.61
27 0.63
28 0.61
29 0.56
30 0.5
31 0.44
32 0.4
33 0.32
34 0.32
35 0.27
36 0.28
37 0.26
38 0.26
39 0.26
40 0.26
41 0.28
42 0.28
43 0.3
44 0.37
45 0.42
46 0.45
47 0.42
48 0.39
49 0.39
50 0.42
51 0.43
52 0.36
53 0.33
54 0.3
55 0.3
56 0.3
57 0.29
58 0.22
59 0.23
60 0.23
61 0.23
62 0.24
63 0.29
64 0.31
65 0.32
66 0.32
67 0.3
68 0.32
69 0.32
70 0.32
71 0.32
72 0.34
73 0.36
74 0.4
75 0.43
76 0.41
77 0.4
78 0.4
79 0.35
80 0.32
81 0.3
82 0.26
83 0.19
84 0.17
85 0.14
86 0.13
87 0.11
88 0.09
89 0.06
90 0.04
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.04
97 0.04
98 0.05
99 0.08
100 0.09
101 0.11
102 0.13
103 0.14
104 0.13
105 0.15
106 0.15
107 0.13
108 0.14
109 0.12
110 0.13
111 0.15
112 0.16
113 0.21
114 0.22
115 0.29
116 0.36
117 0.44
118 0.5
119 0.56
120 0.64
121 0.69
122 0.76
123 0.79
124 0.81
125 0.84
126 0.82
127 0.79
128 0.73
129 0.66
130 0.66
131 0.63
132 0.59
133 0.53
134 0.55
135 0.58
136 0.65
137 0.72