Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3P6B9

Protein Details
Accession A0A1E3P6B9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
111-134PSAGGLKKSKKKKVKLKYHYEDELBasic
NLS Segment(s)
PositionSequence
116-125LKKSKKKKVK
Subcellular Location(s) nucl 16, cyto_nucl 11.333, mito_nucl 9.833, cyto 5.5, mito 2.5
Family & Domain DBs
Amino Acid Sequences MNMNCFDGFDYVCVMYGRKRQKGSYGTVLKYDGMHDSGEESGFKSRGFRSSRAKRFEFKQQDKKDFQDDEDLVSELGHLKLVPNYRDLSSVLELDLKGFETDSIVSTSNIPSAGGLKKSKKKKVKLKYHYEDELDQDSPDFEIKLKSVDSKVKFQRNLPKQQAIKQSSTDTIYKRFIKKEQPSSPKIINTIPDGYVPKYKLGNSDTAPLTKHAATSLLQSRTTTNRAKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.25
4 0.34
5 0.39
6 0.44
7 0.45
8 0.53
9 0.58
10 0.6
11 0.62
12 0.61
13 0.55
14 0.53
15 0.52
16 0.44
17 0.38
18 0.32
19 0.24
20 0.17
21 0.15
22 0.13
23 0.13
24 0.13
25 0.13
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.15
32 0.16
33 0.24
34 0.28
35 0.33
36 0.41
37 0.51
38 0.6
39 0.65
40 0.67
41 0.64
42 0.64
43 0.69
44 0.69
45 0.68
46 0.7
47 0.72
48 0.76
49 0.75
50 0.74
51 0.71
52 0.61
53 0.52
54 0.5
55 0.41
56 0.34
57 0.31
58 0.27
59 0.2
60 0.18
61 0.16
62 0.09
63 0.09
64 0.07
65 0.05
66 0.06
67 0.09
68 0.13
69 0.14
70 0.15
71 0.17
72 0.17
73 0.19
74 0.19
75 0.19
76 0.16
77 0.15
78 0.13
79 0.13
80 0.12
81 0.11
82 0.1
83 0.08
84 0.06
85 0.06
86 0.06
87 0.05
88 0.05
89 0.06
90 0.07
91 0.07
92 0.08
93 0.08
94 0.09
95 0.09
96 0.08
97 0.07
98 0.06
99 0.08
100 0.09
101 0.12
102 0.15
103 0.21
104 0.28
105 0.37
106 0.46
107 0.53
108 0.61
109 0.68
110 0.75
111 0.8
112 0.83
113 0.86
114 0.84
115 0.82
116 0.76
117 0.68
118 0.58
119 0.49
120 0.42
121 0.32
122 0.24
123 0.17
124 0.14
125 0.12
126 0.11
127 0.08
128 0.06
129 0.06
130 0.07
131 0.08
132 0.09
133 0.11
134 0.14
135 0.21
136 0.24
137 0.32
138 0.4
139 0.47
140 0.48
141 0.52
142 0.59
143 0.6
144 0.68
145 0.66
146 0.66
147 0.62
148 0.66
149 0.7
150 0.65
151 0.59
152 0.51
153 0.47
154 0.41
155 0.41
156 0.37
157 0.3
158 0.3
159 0.34
160 0.38
161 0.4
162 0.42
163 0.45
164 0.51
165 0.58
166 0.64
167 0.68
168 0.7
169 0.7
170 0.72
171 0.71
172 0.63
173 0.56
174 0.48
175 0.41
176 0.37
177 0.35
178 0.29
179 0.28
180 0.27
181 0.27
182 0.3
183 0.29
184 0.28
185 0.28
186 0.28
187 0.31
188 0.32
189 0.35
190 0.31
191 0.37
192 0.36
193 0.35
194 0.35
195 0.31
196 0.32
197 0.26
198 0.24
199 0.18
200 0.18
201 0.17
202 0.23
203 0.29
204 0.29
205 0.29
206 0.3
207 0.33
208 0.37
209 0.43