Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B0E8

Protein Details
Accession G3B0E8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-67VTSNAKAYYRKRKFQNRRLRIFAISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 4, cyto 3.5
Family & Domain DBs
KEGG cten:CANTEDRAFT_113106  -  
Amino Acid Sequences MGGALPYASSNGSESGLRSRGLLYMFSLSGHRSTCAHQLPIDVTSNAKAYYRKRKFQNRRLRIFAISTPYTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.17
4 0.17
5 0.16
6 0.15
7 0.16
8 0.16
9 0.16
10 0.12
11 0.12
12 0.12
13 0.12
14 0.12
15 0.11
16 0.11
17 0.11
18 0.11
19 0.1
20 0.12
21 0.17
22 0.19
23 0.19
24 0.17
25 0.18
26 0.18
27 0.19
28 0.19
29 0.13
30 0.11
31 0.12
32 0.12
33 0.12
34 0.13
35 0.15
36 0.21
37 0.33
38 0.4
39 0.47
40 0.56
41 0.67
42 0.77
43 0.83
44 0.87
45 0.86
46 0.87
47 0.86
48 0.81
49 0.73
50 0.66
51 0.6
52 0.57