Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P0X2

Protein Details
Accession A0A1E3P0X2   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
190-216VLMSYRKRRKADTKFFRKIKKHFDLTEHydrophilic
NLS Segment(s)
PositionSequence
196-209KRRKADTKFFRKIK
Subcellular Location(s) cyto_nucl 13.5, cyto 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR033684  EFM6  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016279  F:protein-lysine N-methyltransferase activity  
GO:0018022  P:peptidyl-lysine methylation  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
Amino Acid Sequences MAIVESGPQALDPTPELLFWNEFQDFVPSRPVEHLGESDFTFDGRLPEPGLQIYEDGGELGCGGKIWVAGELLSKYLLDKGLNNKKKVVEIGSGTGLVGLTLGLGQRKNDDMEIWITDIDDLVPLMDKNIILNGLEKNVFARALPWGMELPEFAKKDVDVVLAADCVYLEKAFPLLEKTLIDLTTKDTLVLMSYRKRRKADTKFFRKIKKHFDLTEVTDFKDYAIYLKQGVHLFQLVKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.15
5 0.17
6 0.16
7 0.2
8 0.17
9 0.17
10 0.18
11 0.23
12 0.22
13 0.21
14 0.28
15 0.23
16 0.24
17 0.26
18 0.29
19 0.24
20 0.25
21 0.25
22 0.2
23 0.22
24 0.21
25 0.2
26 0.17
27 0.15
28 0.13
29 0.12
30 0.12
31 0.11
32 0.12
33 0.12
34 0.13
35 0.14
36 0.15
37 0.15
38 0.13
39 0.12
40 0.11
41 0.1
42 0.08
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.05
56 0.06
57 0.07
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.08
64 0.1
65 0.08
66 0.11
67 0.21
68 0.31
69 0.38
70 0.39
71 0.41
72 0.41
73 0.43
74 0.42
75 0.35
76 0.27
77 0.23
78 0.23
79 0.21
80 0.19
81 0.17
82 0.15
83 0.12
84 0.08
85 0.06
86 0.03
87 0.02
88 0.03
89 0.03
90 0.05
91 0.05
92 0.06
93 0.07
94 0.08
95 0.09
96 0.09
97 0.09
98 0.09
99 0.1
100 0.1
101 0.1
102 0.08
103 0.08
104 0.07
105 0.07
106 0.05
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.04
116 0.04
117 0.05
118 0.05
119 0.06
120 0.07
121 0.08
122 0.08
123 0.08
124 0.08
125 0.09
126 0.08
127 0.07
128 0.07
129 0.07
130 0.07
131 0.08
132 0.08
133 0.08
134 0.08
135 0.09
136 0.08
137 0.09
138 0.14
139 0.14
140 0.13
141 0.14
142 0.13
143 0.14
144 0.15
145 0.13
146 0.08
147 0.08
148 0.08
149 0.07
150 0.07
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.04
158 0.05
159 0.05
160 0.06
161 0.08
162 0.09
163 0.1
164 0.1
165 0.12
166 0.13
167 0.14
168 0.14
169 0.12
170 0.15
171 0.17
172 0.16
173 0.14
174 0.13
175 0.12
176 0.13
177 0.15
178 0.15
179 0.2
180 0.3
181 0.38
182 0.45
183 0.48
184 0.55
185 0.64
186 0.71
187 0.74
188 0.76
189 0.79
190 0.83
191 0.88
192 0.9
193 0.88
194 0.86
195 0.85
196 0.84
197 0.81
198 0.73
199 0.71
200 0.67
201 0.65
202 0.66
203 0.56
204 0.48
205 0.41
206 0.38
207 0.32
208 0.28
209 0.21
210 0.14
211 0.17
212 0.16
213 0.17
214 0.18
215 0.23
216 0.23
217 0.24
218 0.24
219 0.24
220 0.25