Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PAG2

Protein Details
Accession A0A1E3PAG2   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
25-55LRSNTKPSKPEPSRKQPRKPKKPVKILTLLEHydrophilic
NLS Segment(s)
PositionSequence
30-48KPSKPEPSRKQPRKPKKPV
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, E.R. 4, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
Gene Ontology GO:0016020  C:membrane  
GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
Amino Acid Sequences MSDTYLTSLGIGISTLLILGTIFYLRSNTKPSKPEPSRKQPRKPKKPVKILTLLERFQLALTTVNTTVRTELEPEVEKYYTDINQISPDDRLYKYNYFQEELLKELIKLDEIDLTLLDDETVKKTLKDERKIIIKHIQGLQKGLDGYKKENSGKYPKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.04
9 0.04
10 0.05
11 0.08
12 0.1
13 0.13
14 0.2
15 0.25
16 0.31
17 0.37
18 0.42
19 0.5
20 0.58
21 0.66
22 0.69
23 0.74
24 0.8
25 0.84
26 0.9
27 0.9
28 0.93
29 0.93
30 0.94
31 0.94
32 0.93
33 0.94
34 0.9
35 0.87
36 0.84
37 0.76
38 0.74
39 0.69
40 0.59
41 0.48
42 0.41
43 0.34
44 0.24
45 0.21
46 0.13
47 0.09
48 0.09
49 0.1
50 0.1
51 0.11
52 0.12
53 0.12
54 0.12
55 0.1
56 0.1
57 0.1
58 0.1
59 0.12
60 0.12
61 0.14
62 0.15
63 0.14
64 0.14
65 0.13
66 0.13
67 0.11
68 0.12
69 0.11
70 0.09
71 0.11
72 0.12
73 0.12
74 0.11
75 0.11
76 0.13
77 0.13
78 0.14
79 0.17
80 0.19
81 0.21
82 0.25
83 0.26
84 0.25
85 0.25
86 0.27
87 0.23
88 0.23
89 0.22
90 0.17
91 0.15
92 0.15
93 0.14
94 0.11
95 0.1
96 0.08
97 0.08
98 0.08
99 0.08
100 0.07
101 0.08
102 0.07
103 0.07
104 0.06
105 0.06
106 0.06
107 0.08
108 0.11
109 0.11
110 0.11
111 0.14
112 0.24
113 0.32
114 0.39
115 0.42
116 0.47
117 0.56
118 0.57
119 0.6
120 0.59
121 0.53
122 0.52
123 0.53
124 0.51
125 0.44
126 0.45
127 0.4
128 0.34
129 0.32
130 0.28
131 0.27
132 0.24
133 0.27
134 0.31
135 0.37
136 0.38
137 0.42
138 0.48