Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3PA90

Protein Details
Accession A0A1E3PA90    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-60LTRAPRGRWNCPLCKNRKKHKBasic
NLS Segment(s)
PositionSequence
57-60KKHK
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
CDD cd15505  PHD_ING  
Amino Acid Sequences DEDNDNHLYCICRRTSFGEMIGCDNPKCKYEWFHYSCVGLTRAPRGRWNCPLCKNRKKHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.31
4 0.32
5 0.3
6 0.29
7 0.3
8 0.3
9 0.26
10 0.22
11 0.21
12 0.19
13 0.17
14 0.17
15 0.15
16 0.17
17 0.21
18 0.31
19 0.33
20 0.35
21 0.35
22 0.34
23 0.34
24 0.32
25 0.28
26 0.19
27 0.17
28 0.22
29 0.27
30 0.28
31 0.36
32 0.39
33 0.45
34 0.53
35 0.6
36 0.6
37 0.64
38 0.72
39 0.75
40 0.8