Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P8G9

Protein Details
Accession A0A1E3P8G9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
104-125KSYGAWIKKYGHKNEKRPSGGNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, cyto 4.5, cyto_nucl 3.5, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
Amino Acid Sequences MNTQPGDYKYPEQQQQQPQQQQQQQSQQPVVIVQHPEQPEQPRQYSTLSKVLLYISVIIPPIPVIIVATDANDIFINLCLLFLFGVGALFHSIYVVYKYTSGEKSYGAWIKKYGHKNEKRPSGGNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.73
4 0.74
5 0.73
6 0.76
7 0.75
8 0.73
9 0.7
10 0.7
11 0.65
12 0.62
13 0.56
14 0.48
15 0.42
16 0.36
17 0.31
18 0.25
19 0.22
20 0.18
21 0.22
22 0.23
23 0.24
24 0.26
25 0.29
26 0.32
27 0.34
28 0.35
29 0.31
30 0.31
31 0.33
32 0.33
33 0.32
34 0.32
35 0.27
36 0.25
37 0.25
38 0.23
39 0.2
40 0.16
41 0.13
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.05
48 0.05
49 0.04
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.04
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.06
82 0.07
83 0.07
84 0.08
85 0.1
86 0.14
87 0.16
88 0.18
89 0.18
90 0.18
91 0.19
92 0.26
93 0.31
94 0.28
95 0.28
96 0.3
97 0.35
98 0.43
99 0.5
100 0.53
101 0.58
102 0.66
103 0.75
104 0.81
105 0.85
106 0.83