Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P6X9

Protein Details
Accession A0A1E3P6X9   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
88-122TIVQEWKHNKRASKKKKSRRKYRKLEEEKKKLQEQBasic
NLS Segment(s)
PositionSequence
94-118KHNKRASKKKKSRRKYRKLEEEKKK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences LAIKNNKLPPRPKIVEDEIEEKFLKGGRGPGGQKINKTNSKVQLKHIPTGIVVTCQETRSQDQNRKRAREILAANVQHALDPENSRQTIVQEWKHNKRASKKKKSRRKYRKLEEEKKKLQEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.55
4 0.54
5 0.45
6 0.44
7 0.4
8 0.33
9 0.27
10 0.22
11 0.19
12 0.15
13 0.18
14 0.18
15 0.24
16 0.26
17 0.32
18 0.39
19 0.4
20 0.43
21 0.46
22 0.5
23 0.5
24 0.53
25 0.53
26 0.53
27 0.6
28 0.58
29 0.57
30 0.58
31 0.55
32 0.54
33 0.48
34 0.39
35 0.3
36 0.3
37 0.24
38 0.16
39 0.13
40 0.13
41 0.12
42 0.12
43 0.13
44 0.13
45 0.16
46 0.21
47 0.27
48 0.33
49 0.4
50 0.49
51 0.55
52 0.58
53 0.57
54 0.56
55 0.52
56 0.52
57 0.46
58 0.43
59 0.43
60 0.38
61 0.37
62 0.32
63 0.29
64 0.21
65 0.2
66 0.15
67 0.1
68 0.12
69 0.14
70 0.18
71 0.18
72 0.18
73 0.18
74 0.18
75 0.23
76 0.27
77 0.31
78 0.36
79 0.44
80 0.53
81 0.61
82 0.63
83 0.64
84 0.68
85 0.74
86 0.75
87 0.78
88 0.81
89 0.83
90 0.9
91 0.94
92 0.95
93 0.95
94 0.95
95 0.95
96 0.95
97 0.96
98 0.96
99 0.96
100 0.96
101 0.95
102 0.94