Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P2B6

Protein Details
Accession A0A1E3P2B6   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
277-296SSFGKVFKKKHQQSFKNGDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
IPR004567  Type_II_PanK  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004594  F:pantothenate kinase activity  
GO:0015937  P:coenzyme A biosynthetic process  
Pfam View protein in Pfam  
PF03630  Fumble  
Amino Acid Sequences MTDTIPQSPVIEPEMDNRIINPGSIQINVTGAFIVDEELYEDEDSIPETSDIALPYQDAENISHIAVDIGGSLAKIVYFTSNQNLSDSGGRLNFYKIETERIDEFIEFIAKLIKFYNKKIHIMATGGGSIKFYDRLKKDLNVQVSKEDEMECLIRGLDFFITEIPNEVFLYTEQNPMEFVNHSKNIIYPYLLVNIGSGVSIIKVMGPNQEDFIRVGGSSLGGGTLWGLLSLLTDANSYDEMLTNAAKGDNSKVDMLVGDIYGTDYNKIGLKKSTIASSFGKVFKKKHQQSFKNGDSELFASADISRSLLYAISNNIGQIAYLQAKIHEVNHIYFGGSYIQGHPQTMNTLSYAINFWSQGTKRAYFLRHEGYLGALGAFLKKQPEGWGRKNSFKMDDNLKTKIRNILKKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.23
5 0.26
6 0.24
7 0.23
8 0.19
9 0.18
10 0.18
11 0.19
12 0.19
13 0.15
14 0.16
15 0.17
16 0.16
17 0.11
18 0.09
19 0.08
20 0.08
21 0.08
22 0.06
23 0.06
24 0.07
25 0.08
26 0.09
27 0.09
28 0.1
29 0.09
30 0.09
31 0.1
32 0.09
33 0.1
34 0.08
35 0.09
36 0.09
37 0.11
38 0.11
39 0.11
40 0.1
41 0.09
42 0.11
43 0.11
44 0.12
45 0.11
46 0.12
47 0.13
48 0.14
49 0.14
50 0.12
51 0.11
52 0.1
53 0.09
54 0.07
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.07
65 0.09
66 0.11
67 0.16
68 0.19
69 0.2
70 0.21
71 0.21
72 0.2
73 0.22
74 0.21
75 0.18
76 0.16
77 0.17
78 0.17
79 0.18
80 0.18
81 0.16
82 0.2
83 0.19
84 0.24
85 0.24
86 0.27
87 0.26
88 0.27
89 0.27
90 0.21
91 0.21
92 0.15
93 0.15
94 0.11
95 0.1
96 0.13
97 0.12
98 0.13
99 0.14
100 0.21
101 0.23
102 0.28
103 0.38
104 0.37
105 0.41
106 0.42
107 0.42
108 0.37
109 0.35
110 0.32
111 0.23
112 0.2
113 0.18
114 0.16
115 0.13
116 0.12
117 0.11
118 0.13
119 0.13
120 0.19
121 0.21
122 0.26
123 0.3
124 0.32
125 0.39
126 0.41
127 0.48
128 0.44
129 0.44
130 0.41
131 0.39
132 0.38
133 0.31
134 0.25
135 0.17
136 0.14
137 0.13
138 0.1
139 0.09
140 0.08
141 0.07
142 0.06
143 0.07
144 0.06
145 0.05
146 0.05
147 0.06
148 0.06
149 0.06
150 0.08
151 0.07
152 0.08
153 0.08
154 0.08
155 0.07
156 0.07
157 0.12
158 0.11
159 0.15
160 0.14
161 0.14
162 0.14
163 0.14
164 0.15
165 0.11
166 0.12
167 0.14
168 0.15
169 0.16
170 0.15
171 0.16
172 0.17
173 0.17
174 0.15
175 0.11
176 0.11
177 0.12
178 0.12
179 0.11
180 0.08
181 0.08
182 0.07
183 0.06
184 0.05
185 0.03
186 0.03
187 0.03
188 0.03
189 0.04
190 0.04
191 0.05
192 0.08
193 0.09
194 0.09
195 0.1
196 0.11
197 0.11
198 0.11
199 0.11
200 0.09
201 0.07
202 0.07
203 0.06
204 0.05
205 0.05
206 0.04
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.02
214 0.03
215 0.02
216 0.03
217 0.03
218 0.03
219 0.03
220 0.04
221 0.04
222 0.05
223 0.05
224 0.05
225 0.05
226 0.06
227 0.06
228 0.07
229 0.07
230 0.06
231 0.06
232 0.06
233 0.06
234 0.06
235 0.08
236 0.09
237 0.11
238 0.11
239 0.1
240 0.1
241 0.1
242 0.1
243 0.08
244 0.07
245 0.05
246 0.04
247 0.05
248 0.06
249 0.06
250 0.06
251 0.06
252 0.07
253 0.1
254 0.11
255 0.12
256 0.13
257 0.15
258 0.18
259 0.2
260 0.23
261 0.21
262 0.25
263 0.25
264 0.26
265 0.28
266 0.3
267 0.34
268 0.34
269 0.36
270 0.42
271 0.52
272 0.58
273 0.63
274 0.69
275 0.72
276 0.78
277 0.84
278 0.8
279 0.74
280 0.65
281 0.56
282 0.47
283 0.4
284 0.31
285 0.21
286 0.15
287 0.1
288 0.1
289 0.11
290 0.09
291 0.08
292 0.07
293 0.07
294 0.07
295 0.07
296 0.07
297 0.08
298 0.09
299 0.1
300 0.1
301 0.1
302 0.1
303 0.1
304 0.09
305 0.08
306 0.1
307 0.1
308 0.11
309 0.11
310 0.11
311 0.13
312 0.14
313 0.15
314 0.17
315 0.17
316 0.17
317 0.2
318 0.2
319 0.18
320 0.17
321 0.17
322 0.14
323 0.12
324 0.12
325 0.11
326 0.17
327 0.17
328 0.18
329 0.18
330 0.17
331 0.2
332 0.2
333 0.19
334 0.14
335 0.15
336 0.14
337 0.15
338 0.15
339 0.13
340 0.13
341 0.12
342 0.13
343 0.19
344 0.2
345 0.26
346 0.3
347 0.31
348 0.33
349 0.39
350 0.41
351 0.39
352 0.45
353 0.44
354 0.4
355 0.39
356 0.36
357 0.31
358 0.29
359 0.24
360 0.17
361 0.11
362 0.1
363 0.1
364 0.11
365 0.11
366 0.12
367 0.12
368 0.14
369 0.22
370 0.31
371 0.39
372 0.47
373 0.57
374 0.6
375 0.69
376 0.74
377 0.71
378 0.68
379 0.64
380 0.62
381 0.61
382 0.65
383 0.61
384 0.62
385 0.61
386 0.57
387 0.56
388 0.58
389 0.58
390 0.59