Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YQ84

Protein Details
Accession C7YQ84   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
165-192RGDGRRERKEKVKRNERMMRKNERDAVSBasic
NLS Segment(s)
PositionSequence
87-118REKPVPEAKPPTKWERFAAKKGIKPKTREQRR
164-201VRGDGRRERKEKVKRNERMMRKNERDAVSKSGGKKKRA
Subcellular Location(s) nucl 18, mito 4.5, cyto_mito 4.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG nhe:NECHADRAFT_102557  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MALPSSRPKLPVAVEKPTPYTFDLGHLLAEDPNPVDLDKTDLEQSLAELARDGAQSLINQLLTTCPLSSTTEGVLLSLPAPSTRLPREKPVPEAKPPTKWERFAAKKGIKPKTREQRRNLAYDEESGEWKRKWGYKGLNKKGEDDWLVEVNPEKEMNRKEGTSVRGDGRRERKEKVKRNERMMRKNERDAVSKSGGKKKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.51
4 0.48
5 0.45
6 0.37
7 0.33
8 0.26
9 0.25
10 0.25
11 0.21
12 0.19
13 0.17
14 0.16
15 0.15
16 0.15
17 0.12
18 0.09
19 0.09
20 0.1
21 0.09
22 0.09
23 0.08
24 0.12
25 0.12
26 0.13
27 0.14
28 0.14
29 0.14
30 0.13
31 0.13
32 0.13
33 0.13
34 0.11
35 0.1
36 0.1
37 0.11
38 0.11
39 0.11
40 0.07
41 0.08
42 0.08
43 0.09
44 0.1
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.1
51 0.08
52 0.07
53 0.09
54 0.11
55 0.12
56 0.12
57 0.11
58 0.12
59 0.12
60 0.12
61 0.1
62 0.08
63 0.07
64 0.06
65 0.06
66 0.04
67 0.06
68 0.06
69 0.1
70 0.15
71 0.21
72 0.22
73 0.29
74 0.36
75 0.38
76 0.44
77 0.48
78 0.48
79 0.48
80 0.55
81 0.51
82 0.5
83 0.52
84 0.53
85 0.48
86 0.46
87 0.44
88 0.45
89 0.47
90 0.45
91 0.51
92 0.48
93 0.47
94 0.54
95 0.6
96 0.56
97 0.56
98 0.61
99 0.63
100 0.69
101 0.74
102 0.71
103 0.72
104 0.71
105 0.7
106 0.63
107 0.56
108 0.46
109 0.39
110 0.36
111 0.26
112 0.24
113 0.21
114 0.22
115 0.18
116 0.18
117 0.2
118 0.23
119 0.24
120 0.3
121 0.39
122 0.45
123 0.57
124 0.65
125 0.7
126 0.66
127 0.67
128 0.6
129 0.55
130 0.46
131 0.37
132 0.3
133 0.23
134 0.22
135 0.19
136 0.2
137 0.16
138 0.15
139 0.14
140 0.12
141 0.17
142 0.19
143 0.24
144 0.25
145 0.25
146 0.27
147 0.32
148 0.35
149 0.33
150 0.35
151 0.35
152 0.37
153 0.4
154 0.46
155 0.5
156 0.56
157 0.56
158 0.59
159 0.63
160 0.69
161 0.77
162 0.79
163 0.8
164 0.79
165 0.85
166 0.89
167 0.89
168 0.89
169 0.88
170 0.88
171 0.85
172 0.85
173 0.83
174 0.77
175 0.73
176 0.66
177 0.64
178 0.59
179 0.57
180 0.55
181 0.57