Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3P6H1

Protein Details
Accession A0A1E3P6H1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
74-99YFKAYRECKKEWLRQRRQDNFNGKGWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MDPAIAKEKGKIDFTKGSVNEYKFYPDNPTSEYNKSKFASKEPSKYYDPCAQSAQMSVRCLEDNNFDRDMCHEYFKAYRECKKEWLRQRRQDNFNGKGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.4
4 0.42
5 0.43
6 0.43
7 0.39
8 0.34
9 0.36
10 0.28
11 0.29
12 0.3
13 0.25
14 0.26
15 0.27
16 0.31
17 0.31
18 0.36
19 0.41
20 0.36
21 0.39
22 0.38
23 0.39
24 0.36
25 0.36
26 0.41
27 0.41
28 0.47
29 0.45
30 0.49
31 0.47
32 0.47
33 0.47
34 0.44
35 0.4
36 0.34
37 0.32
38 0.27
39 0.24
40 0.24
41 0.23
42 0.19
43 0.18
44 0.16
45 0.16
46 0.15
47 0.16
48 0.15
49 0.18
50 0.19
51 0.22
52 0.23
53 0.21
54 0.21
55 0.23
56 0.27
57 0.21
58 0.21
59 0.18
60 0.19
61 0.22
62 0.26
63 0.32
64 0.33
65 0.4
66 0.43
67 0.46
68 0.53
69 0.59
70 0.65
71 0.68
72 0.73
73 0.77
74 0.81
75 0.89
76 0.89
77 0.87
78 0.87
79 0.86