Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P3Q4

Protein Details
Accession A0A1E3P3Q4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-115NPMTIKEVTKRRNRRVRHAISKRHKTRLRVTEIKHydrophilic
NLS Segment(s)
PositionSequence
90-109TKRRNRRVRHAISKRHKTRL
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences DLSPLKLSNELYAVVRVHGNPFLVTEGDIMNLPYHLKTADVGDVLHFTDVTTIGTRNFTYANEPVDPRLVSIKAVVIEKTKNPMTIKEVTKRRNRRVRHAISKRHKTRLRVTEIKLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.17
5 0.17
6 0.17
7 0.14
8 0.14
9 0.14
10 0.13
11 0.12
12 0.11
13 0.09
14 0.09
15 0.09
16 0.09
17 0.07
18 0.07
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.09
27 0.09
28 0.09
29 0.08
30 0.09
31 0.09
32 0.08
33 0.07
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.08
42 0.08
43 0.08
44 0.09
45 0.08
46 0.11
47 0.12
48 0.14
49 0.14
50 0.14
51 0.14
52 0.16
53 0.16
54 0.13
55 0.14
56 0.12
57 0.1
58 0.11
59 0.11
60 0.11
61 0.12
62 0.12
63 0.12
64 0.14
65 0.15
66 0.2
67 0.2
68 0.23
69 0.23
70 0.25
71 0.28
72 0.33
73 0.38
74 0.42
75 0.49
76 0.53
77 0.63
78 0.7
79 0.76
80 0.78
81 0.79
82 0.81
83 0.83
84 0.85
85 0.86
86 0.86
87 0.87
88 0.89
89 0.93
90 0.91
91 0.9
92 0.86
93 0.82
94 0.82
95 0.81
96 0.8
97 0.78