Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P2A3

Protein Details
Accession A0A1E3P2A3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-108EVYRLKINQSRKRRGKGAPKKKKEKGGDKKKKKBasic
NLS Segment(s)
PositionSequence
85-108SRKRRGKGAPKKKKEKGGDKKKKK
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSSFLPPKSRLLELTKLRCNIFNENFNPLNIRTGSKILTQRLKGENIKRYYGNPDMIRFKELRSLYPTIDWVDPAEVYRLKINQSRKRRGKGAPKKKKEKGGDKKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.56
3 0.55
4 0.54
5 0.54
6 0.52
7 0.52
8 0.48
9 0.47
10 0.43
11 0.46
12 0.46
13 0.41
14 0.4
15 0.31
16 0.3
17 0.23
18 0.22
19 0.18
20 0.18
21 0.2
22 0.22
23 0.26
24 0.28
25 0.33
26 0.33
27 0.36
28 0.38
29 0.41
30 0.42
31 0.44
32 0.47
33 0.44
34 0.45
35 0.4
36 0.39
37 0.39
38 0.36
39 0.35
40 0.28
41 0.29
42 0.3
43 0.3
44 0.31
45 0.26
46 0.23
47 0.24
48 0.23
49 0.22
50 0.23
51 0.24
52 0.23
53 0.23
54 0.24
55 0.2
56 0.19
57 0.17
58 0.13
59 0.11
60 0.11
61 0.1
62 0.12
63 0.11
64 0.12
65 0.15
66 0.15
67 0.18
68 0.24
69 0.34
70 0.4
71 0.5
72 0.6
73 0.66
74 0.73
75 0.77
76 0.81
77 0.82
78 0.84
79 0.85
80 0.85
81 0.87
82 0.9
83 0.91
84 0.92
85 0.91
86 0.91
87 0.9
88 0.91