Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PAE1

Protein Details
Accession A0A1E3PAE1   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
112-131RVDVSKYRKKLKDENSRLDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 12.833, cyto 10.5, cyto_pero 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR009316  COG2  
IPR024602  COG_su2_N  
Gene Ontology GO:0005794  C:Golgi apparatus  
GO:0016020  C:membrane  
GO:0007030  P:Golgi organization  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06148  COG2  
Amino Acid Sequences MAATFEEELNFENEEFPFPKTITRETFLNDLQIDPTNPAQSIVRINEVKFNVDQFLFDHYRFTSLEDLQAELSSLLKELDQELFNLVNNDYFDFINLGKSLEGGENLVDRLRVDVSKYRKKLKDENSRLDESKKHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.17
5 0.16
6 0.2
7 0.22
8 0.27
9 0.28
10 0.3
11 0.3
12 0.31
13 0.35
14 0.31
15 0.31
16 0.26
17 0.22
18 0.21
19 0.21
20 0.18
21 0.16
22 0.17
23 0.15
24 0.14
25 0.15
26 0.13
27 0.13
28 0.17
29 0.16
30 0.2
31 0.2
32 0.2
33 0.25
34 0.25
35 0.26
36 0.22
37 0.21
38 0.17
39 0.15
40 0.16
41 0.11
42 0.16
43 0.15
44 0.15
45 0.16
46 0.14
47 0.16
48 0.16
49 0.17
50 0.14
51 0.12
52 0.14
53 0.13
54 0.13
55 0.12
56 0.11
57 0.1
58 0.07
59 0.07
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.07
67 0.07
68 0.08
69 0.09
70 0.09
71 0.09
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.08
86 0.08
87 0.09
88 0.08
89 0.08
90 0.07
91 0.08
92 0.08
93 0.08
94 0.09
95 0.08
96 0.07
97 0.09
98 0.1
99 0.1
100 0.13
101 0.2
102 0.29
103 0.4
104 0.46
105 0.54
106 0.59
107 0.66
108 0.72
109 0.75
110 0.78
111 0.77
112 0.82
113 0.79
114 0.79
115 0.75
116 0.69