FuNGI

A0A1E3P5T3

Protein Details

Accession

A0A1E3P5T3

Localization Confidence

Low

Confidence Score

8.2

NoLS Segment(s)

Position	Sequence	Protein Nature
52-76	TNDNFGKDQKDKFRKNQRDYFQAYG	Hydrophilic
140-162	NKPSGPRKPFNPVRRNNWRDDKP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto 8, cyto_mito 7.833, cyto_nucl 6.833, mito 6.5, extr 5, nucl 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR007783 eIF3d
Gene Ontology	GO:0005852 C:eukaryotic translation initiation factor 3 complex GO:0003723 F:RNA binding GO:0003743 F:translation initiation factor activity
Pfam	View protein in Pfam PF05091 eIF-3_zeta

Amino Acid Sequences

MTSAPFDLSSLAPAANSWGPPSTVPDELRFSDIPYAPFSKGDKLGKAADWNTNDNFGKDQKDKFRKNQRDYFQAYGTSAASSFAAEANDDDAFSVVDSTKTQAPRNQTSTTLLKGRRGGQQGGGFQKRQFAGGAAGGAQNKPSGPRKPFNPVRRNNWRDDKPERVRDSSVKVDESWKVISDIELSKLTKLNFEVNSGEELDTYGALNLYNKKIERTAGAPLKVIDRAFYNPSASDDPVIQELSAKKTAKVYTTDSVITQLMCASKSVYSWDIVVTKKDGVIFFDKRDGSEIDRITVDENAYDAPSDSHDANINNAQNLSLEATFINQNFLANSVFDENVVKYHPNPFHDSSEPLLSKGYRYKKFSFRANDEEEEPVSVVVRTEVDSKDAATNQTLAVKAVNEYNNNGLDWKSKFTSQRGAIIAAELKNNNNKFSKWTNQAILAGVDTIKLGFVSRANFKDNTKHVILGVSSYRPQDLAMQINLSTGNGWGIVKSYIDIISAEDDGKFVILKHPNSPKLTVYKVPENAFQDEE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.14
2	0.15
3	0.15
4	0.15
5	0.16
6	0.17
7	0.18
8	0.24
9	0.23
10	0.26
11	0.28
12	0.3
13	0.33
14	0.34
15	0.39
16	0.33
17	0.31
18	0.33
19	0.34
20	0.31
21	0.31
22	0.33
23	0.29
24	0.32
25	0.32
26	0.31
27	0.35
28	0.39
29	0.37
30	0.38
31	0.4
32	0.39
33	0.44
34	0.41
35	0.41
36	0.41
37	0.42
38	0.39
39	0.43
40	0.41
41	0.35
42	0.35
43	0.31
44	0.35
45	0.36
46	0.42
47	0.46
48	0.56
49	0.63
50	0.7
51	0.78
52	0.81
53	0.86
54	0.88
55	0.84
56	0.83
57	0.81
58	0.75
59	0.67
60	0.58
61	0.49
62	0.41
63	0.34
64	0.25
65	0.19
66	0.14
67	0.11
68	0.09
69	0.09
70	0.08
71	0.08
72	0.08
73	0.08
74	0.09
75	0.09
76	0.09
77	0.08
78	0.07
79	0.07
80	0.07
81	0.08
82	0.06
83	0.07
84	0.08
85	0.1
86	0.15
87	0.19
88	0.22
89	0.26
90	0.33
91	0.41
92	0.45
93	0.45
94	0.42
95	0.44
96	0.44
97	0.44
98	0.44
99	0.39
100	0.38
101	0.41
102	0.43
103	0.45
104	0.46
105	0.43
106	0.41
107	0.44
108	0.45
109	0.49
110	0.5
111	0.44
112	0.4
113	0.43
114	0.37
115	0.33
116	0.28
117	0.2
118	0.17
119	0.16
120	0.16
121	0.11
122	0.13
123	0.13
124	0.13
125	0.12
126	0.1
127	0.1
128	0.14
129	0.2
130	0.26
131	0.32
132	0.38
133	0.42
134	0.52
135	0.61
136	0.67
137	0.71
138	0.71
139	0.75
140	0.8
141	0.81
142	0.79
143	0.8
144	0.76
145	0.73
146	0.71
147	0.72
148	0.7
149	0.74
150	0.7
151	0.64
152	0.61
153	0.57
154	0.56
155	0.53
156	0.46
157	0.38
158	0.34
159	0.34
160	0.32
161	0.3
162	0.25
163	0.19
164	0.17
165	0.15
166	0.15
167	0.14
168	0.14
169	0.14
170	0.16
171	0.15
172	0.16
173	0.19
174	0.19
175	0.17
176	0.18
177	0.21
178	0.19
179	0.2
180	0.2
181	0.18
182	0.2
183	0.19
184	0.17
185	0.11
186	0.11
187	0.09
188	0.08
189	0.07
190	0.06
191	0.05
192	0.05
193	0.07
194	0.09
195	0.11
196	0.14
197	0.14
198	0.15
199	0.17
200	0.18
201	0.17
202	0.17
203	0.23
204	0.25
205	0.25
206	0.25
207	0.24
208	0.25
209	0.25
210	0.23
211	0.15
212	0.12
213	0.14
214	0.15
215	0.15
216	0.15
217	0.13
218	0.16
219	0.18
220	0.16
221	0.14
222	0.12
223	0.12
224	0.12
225	0.12
226	0.09
227	0.09
228	0.1
229	0.13
230	0.18
231	0.18
232	0.17
233	0.21
234	0.23
235	0.23
236	0.25
237	0.26
238	0.22
239	0.24
240	0.24
241	0.2
242	0.2
243	0.18
244	0.14
245	0.1
246	0.09
247	0.08
248	0.07
249	0.07
250	0.07
251	0.06
252	0.07
253	0.09
254	0.08
255	0.08
256	0.08
257	0.09
258	0.11
259	0.12
260	0.12
261	0.12
262	0.11
263	0.11
264	0.13
265	0.12
266	0.12
267	0.17
268	0.18
269	0.18
270	0.22
271	0.22
272	0.2
273	0.22
274	0.21
275	0.18
276	0.22
277	0.21
278	0.17
279	0.17
280	0.17
281	0.16
282	0.16
283	0.13
284	0.07
285	0.07
286	0.06
287	0.06
288	0.06
289	0.05
290	0.05
291	0.06
292	0.08
293	0.07
294	0.08
295	0.1
296	0.1
297	0.12
298	0.16
299	0.16
300	0.15
301	0.15
302	0.14
303	0.11
304	0.12
305	0.11
306	0.07
307	0.07
308	0.06
309	0.08
310	0.09
311	0.09
312	0.1
313	0.08
314	0.08
315	0.08
316	0.09
317	0.09
318	0.07
319	0.08
320	0.08
321	0.08
322	0.08
323	0.09
324	0.08
325	0.09
326	0.1
327	0.1
328	0.09
329	0.17
330	0.2
331	0.22
332	0.28
333	0.31
334	0.34
335	0.35
336	0.36
337	0.31
338	0.35
339	0.31
340	0.26
341	0.24
342	0.2
343	0.2
344	0.26
345	0.33
346	0.33
347	0.39
348	0.45
349	0.52
350	0.58
351	0.64
352	0.65
353	0.62
354	0.64
355	0.63
356	0.59
357	0.52
358	0.48
359	0.4
360	0.32
361	0.25
362	0.17
363	0.12
364	0.1
365	0.08
366	0.06
367	0.07
368	0.07
369	0.1
370	0.11
371	0.12
372	0.12
373	0.13
374	0.16
375	0.17
376	0.17
377	0.14
378	0.15
379	0.14
380	0.16
381	0.15
382	0.13
383	0.12
384	0.11
385	0.11
386	0.16
387	0.18
388	0.17
389	0.18
390	0.21
391	0.22
392	0.21
393	0.21
394	0.17
395	0.19
396	0.19
397	0.22
398	0.21
399	0.25
400	0.29
401	0.32
402	0.41
403	0.38
404	0.43
405	0.4
406	0.4
407	0.35
408	0.33
409	0.33
410	0.25
411	0.25
412	0.2
413	0.21
414	0.27
415	0.29
416	0.32
417	0.31
418	0.3
419	0.33
420	0.39
421	0.44
422	0.44
423	0.48
424	0.47
425	0.47
426	0.48
427	0.43
428	0.37
429	0.28
430	0.22
431	0.15
432	0.12
433	0.09
434	0.07
435	0.06
436	0.05
437	0.06
438	0.06
439	0.09
440	0.13
441	0.2
442	0.23
443	0.27
444	0.3
445	0.32
446	0.4
447	0.41
448	0.44
449	0.4
450	0.38
451	0.34
452	0.34
453	0.32
454	0.27
455	0.26
456	0.23
457	0.23
458	0.23
459	0.23
460	0.2
461	0.21
462	0.22
463	0.23
464	0.25
465	0.24
466	0.24
467	0.23
468	0.24
469	0.24
470	0.19
471	0.15
472	0.1
473	0.08
474	0.08
475	0.08
476	0.07
477	0.09
478	0.1
479	0.1
480	0.1
481	0.11
482	0.1
483	0.11
484	0.11
485	0.11
486	0.12
487	0.13
488	0.13
489	0.11
490	0.11
491	0.1
492	0.1
493	0.09
494	0.08
495	0.15
496	0.22
497	0.24
498	0.33
499	0.43
500	0.5
501	0.54
502	0.56
503	0.54
504	0.54
505	0.58
506	0.56
507	0.54
508	0.55
509	0.58
510	0.58
511	0.58
512	0.56

A0A1E3P5T3

3D AlphaFold-predicted Structure Viewer