Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P2K7

Protein Details
Accession A0A1E3P2K7    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-42GLLWKIPWRMSKHQKYRHRKRMQSVDEVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKATNVALGGLLWKIPWRMSKHQKYRHRKRMQSVDEVIKTLYQGLKQTGQSNPKIERFYFNYPKESQMDPFDKYFVYNKYSKGYRKGVHKVPKFTKLSIRENPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.08
5 0.09
6 0.11
7 0.18
8 0.24
9 0.34
10 0.45
11 0.56
12 0.65
13 0.74
14 0.82
15 0.87
16 0.91
17 0.92
18 0.92
19 0.89
20 0.88
21 0.89
22 0.84
23 0.8
24 0.75
25 0.71
26 0.61
27 0.54
28 0.44
29 0.33
30 0.27
31 0.21
32 0.16
33 0.1
34 0.1
35 0.12
36 0.15
37 0.16
38 0.19
39 0.22
40 0.25
41 0.27
42 0.29
43 0.3
44 0.31
45 0.32
46 0.3
47 0.3
48 0.31
49 0.37
50 0.42
51 0.41
52 0.42
53 0.41
54 0.44
55 0.42
56 0.38
57 0.32
58 0.3
59 0.31
60 0.28
61 0.28
62 0.25
63 0.22
64 0.22
65 0.24
66 0.2
67 0.22
68 0.22
69 0.24
70 0.29
71 0.36
72 0.39
73 0.43
74 0.49
75 0.49
76 0.56
77 0.63
78 0.66
79 0.7
80 0.73
81 0.76
82 0.74
83 0.79
84 0.73
85 0.68
86 0.68
87 0.66
88 0.67
89 0.66
90 0.69