Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PBS3

Protein Details
Accession A0A1E3PBS3   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
175-194RLRQLAKKVKRRYRESRSSRBasic
NLS Segment(s)
PositionSequence
174-189HRLRQLAKKVKRRYRE
Subcellular Location(s) nucl 16.5, cyto_nucl 11.833, mito_nucl 11.166, cyto 5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000008  C2_dom  
IPR035892  C2_domain_sf  
PROSITE View protein in PROSITE  
PS50004  C2  
Amino Acid Sequences MEFSSAKGILVVDPIEARNICIKRASSNVYCLFQIDNRVYRSKTTAFKVPSLPRWKEDSQCRFDIDPGVTPLLKVFVLEKTNGLPLVVGKGELNLIDIFYEKKSDRWVKLSPMGQLDLELTFYQAAPMLPRKTLPNPKVPPKHPQREGEIKENLKQKVSSVDQVFEEENREERHRLRQLAKKVKRRYRESRSSREFVMKEQLKKMTNDELLYVEVNQKIEKALPDVPGDDSVKIEENIPDINVLSIDTESISQIDLNKLPFSADSIGTHMITKLDELKAQQEKQKEEDSKKMYTPLSTEAFSIISRLERGRARPKDLQVEGGASDYKGDGTWGKGRLTDAAYTGERPRLPPKIPYGMNAEEYYMLQRREYVDYFKTVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.16
4 0.17
5 0.23
6 0.24
7 0.24
8 0.28
9 0.29
10 0.29
11 0.36
12 0.41
13 0.36
14 0.44
15 0.47
16 0.44
17 0.43
18 0.39
19 0.35
20 0.3
21 0.33
22 0.31
23 0.32
24 0.34
25 0.38
26 0.39
27 0.39
28 0.43
29 0.42
30 0.43
31 0.42
32 0.47
33 0.45
34 0.49
35 0.55
36 0.56
37 0.59
38 0.62
39 0.61
40 0.56
41 0.6
42 0.6
43 0.59
44 0.63
45 0.63
46 0.6
47 0.59
48 0.59
49 0.53
50 0.5
51 0.47
52 0.38
53 0.32
54 0.28
55 0.28
56 0.24
57 0.22
58 0.21
59 0.17
60 0.15
61 0.12
62 0.11
63 0.13
64 0.15
65 0.16
66 0.17
67 0.16
68 0.18
69 0.18
70 0.16
71 0.12
72 0.1
73 0.12
74 0.11
75 0.1
76 0.08
77 0.09
78 0.09
79 0.09
80 0.1
81 0.07
82 0.07
83 0.07
84 0.07
85 0.08
86 0.08
87 0.12
88 0.11
89 0.12
90 0.21
91 0.29
92 0.32
93 0.36
94 0.39
95 0.41
96 0.48
97 0.49
98 0.44
99 0.39
100 0.37
101 0.31
102 0.28
103 0.23
104 0.16
105 0.14
106 0.11
107 0.08
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.08
114 0.14
115 0.15
116 0.15
117 0.17
118 0.21
119 0.28
120 0.38
121 0.4
122 0.44
123 0.5
124 0.59
125 0.67
126 0.66
127 0.68
128 0.69
129 0.74
130 0.7
131 0.68
132 0.65
133 0.66
134 0.67
135 0.64
136 0.61
137 0.53
138 0.52
139 0.54
140 0.48
141 0.4
142 0.35
143 0.29
144 0.28
145 0.29
146 0.29
147 0.24
148 0.24
149 0.23
150 0.24
151 0.24
152 0.18
153 0.18
154 0.12
155 0.13
156 0.14
157 0.16
158 0.16
159 0.18
160 0.26
161 0.29
162 0.34
163 0.39
164 0.44
165 0.52
166 0.61
167 0.68
168 0.69
169 0.74
170 0.76
171 0.78
172 0.8
173 0.8
174 0.78
175 0.81
176 0.79
177 0.8
178 0.79
179 0.72
180 0.65
181 0.62
182 0.52
183 0.43
184 0.44
185 0.39
186 0.35
187 0.36
188 0.39
189 0.35
190 0.35
191 0.36
192 0.32
193 0.29
194 0.27
195 0.24
196 0.2
197 0.18
198 0.18
199 0.16
200 0.12
201 0.11
202 0.11
203 0.1
204 0.09
205 0.09
206 0.1
207 0.1
208 0.11
209 0.12
210 0.14
211 0.15
212 0.16
213 0.16
214 0.18
215 0.18
216 0.15
217 0.13
218 0.12
219 0.12
220 0.12
221 0.12
222 0.09
223 0.1
224 0.1
225 0.1
226 0.09
227 0.07
228 0.07
229 0.06
230 0.06
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.07
241 0.09
242 0.1
243 0.11
244 0.12
245 0.11
246 0.12
247 0.11
248 0.13
249 0.13
250 0.12
251 0.11
252 0.14
253 0.15
254 0.15
255 0.15
256 0.13
257 0.12
258 0.1
259 0.11
260 0.12
261 0.11
262 0.13
263 0.13
264 0.21
265 0.27
266 0.3
267 0.33
268 0.36
269 0.38
270 0.41
271 0.49
272 0.49
273 0.47
274 0.53
275 0.54
276 0.52
277 0.5
278 0.51
279 0.44
280 0.37
281 0.35
282 0.31
283 0.29
284 0.26
285 0.24
286 0.2
287 0.2
288 0.18
289 0.16
290 0.11
291 0.1
292 0.12
293 0.12
294 0.17
295 0.2
296 0.27
297 0.37
298 0.43
299 0.49
300 0.55
301 0.6
302 0.64
303 0.61
304 0.58
305 0.49
306 0.45
307 0.37
308 0.32
309 0.26
310 0.16
311 0.15
312 0.11
313 0.1
314 0.08
315 0.09
316 0.09
317 0.13
318 0.19
319 0.22
320 0.22
321 0.24
322 0.25
323 0.28
324 0.29
325 0.26
326 0.22
327 0.23
328 0.24
329 0.25
330 0.27
331 0.29
332 0.28
333 0.3
334 0.36
335 0.38
336 0.4
337 0.44
338 0.49
339 0.53
340 0.53
341 0.53
342 0.53
343 0.49
344 0.5
345 0.43
346 0.37
347 0.28
348 0.28
349 0.3
350 0.28
351 0.24
352 0.21
353 0.23
354 0.25
355 0.3
356 0.33
357 0.34
358 0.32