Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P2X8

Protein Details
Accession A0A1E3P2X8   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
59-80EDSESKRKPEEQPAKKEKRDVVBasic
NLS Segment(s)
PositionSequence
64-76KRKPEEQPAKKEK
Subcellular Location(s) nucl 21, cyto_nucl 12.333, mito_nucl 12.333, mito 2.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSEEVKETPVAPAPVEESKEAKEAEVEAKPTESKEEVKESKEEETKEEKPAETKEEAKEDSESKRKPEEQPAKKEKRDVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.19
5 0.2
6 0.23
7 0.22
8 0.18
9 0.16
10 0.15
11 0.17
12 0.17
13 0.17
14 0.14
15 0.16
16 0.16
17 0.15
18 0.16
19 0.14
20 0.14
21 0.15
22 0.22
23 0.23
24 0.25
25 0.26
26 0.25
27 0.27
28 0.29
29 0.27
30 0.23
31 0.28
32 0.28
33 0.31
34 0.31
35 0.27
36 0.27
37 0.28
38 0.28
39 0.25
40 0.27
41 0.26
42 0.29
43 0.3
44 0.28
45 0.29
46 0.28
47 0.32
48 0.37
49 0.37
50 0.36
51 0.43
52 0.47
53 0.5
54 0.58
55 0.62
56 0.63
57 0.71
58 0.78
59 0.81
60 0.8