Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3P982

Protein Details
Accession A0A1E3P982    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-41AMAGGKKSKKKWSKGRVKDKAQHVVIHydrophilic
NLS Segment(s)
PositionSequence
11-34AKAAAAMAGGKKSKKKWSKGRVKD
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKIQQSKAAKAAAAMAGGKKSKKKWSKGRVKDKAQHVVILDQDKYDRIVKEVPTFRYISVSVLVDRLKIGGSVARVAVQQLEREGLIKAVSRHSSQLIYTRATASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.2
4 0.14
5 0.16
6 0.19
7 0.22
8 0.25
9 0.3
10 0.39
11 0.47
12 0.56
13 0.63
14 0.71
15 0.79
16 0.84
17 0.9
18 0.9
19 0.9
20 0.88
21 0.85
22 0.83
23 0.73
24 0.64
25 0.54
26 0.45
27 0.38
28 0.33
29 0.25
30 0.16
31 0.16
32 0.14
33 0.15
34 0.16
35 0.13
36 0.12
37 0.15
38 0.16
39 0.23
40 0.27
41 0.27
42 0.27
43 0.28
44 0.26
45 0.25
46 0.24
47 0.17
48 0.14
49 0.13
50 0.11
51 0.12
52 0.12
53 0.1
54 0.1
55 0.09
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.09
66 0.12
67 0.11
68 0.11
69 0.11
70 0.12
71 0.11
72 0.12
73 0.12
74 0.1
75 0.1
76 0.12
77 0.13
78 0.18
79 0.21
80 0.22
81 0.24
82 0.26
83 0.26
84 0.26
85 0.31
86 0.29
87 0.29
88 0.29