Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P4N2

Protein Details
Accession A0A1E3P4N2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
27-48SFVCCNKKLNKVCRPNCDHYPKHydrophilic
NLS Segment(s)
PositionSequence
167-173GKKKRRG
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035451  Ada-like_dom_sf  
IPR004026  Ada_DNA_repair_Zn-bd  
IPR009057  Homeobox-like_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0008168  F:methyltransferase activity  
GO:0008270  F:zinc ion binding  
GO:0006281  P:DNA repair  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02805  Ada_Zn_binding  
Amino Acid Sequences MSQTSSYTSDNARYEAYQFSDPFATASFVCCNKKLNKVCRPNCDHYPKVTSKEDVSFLFDANQAASIGFEPCEHCDPCNPNSQLDLPLIKITIESINYSIGFTNDANELKRRAFSVPSINTNNGHYDRQLTRNESEHIKLVELACRHIAAAAALSISKQSEESAQGGKKKRRGGVLGFKELASKSKLSPWHFHRVFKSVTGLTPKSYGDQCWKFIKDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.27
4 0.26
5 0.24
6 0.25
7 0.24
8 0.23
9 0.22
10 0.19
11 0.17
12 0.12
13 0.15
14 0.17
15 0.21
16 0.24
17 0.24
18 0.3
19 0.33
20 0.43
21 0.49
22 0.55
23 0.61
24 0.69
25 0.75
26 0.79
27 0.83
28 0.8
29 0.81
30 0.8
31 0.73
32 0.67
33 0.67
34 0.62
35 0.59
36 0.55
37 0.48
38 0.42
39 0.42
40 0.39
41 0.32
42 0.32
43 0.26
44 0.23
45 0.21
46 0.19
47 0.16
48 0.13
49 0.13
50 0.08
51 0.08
52 0.08
53 0.07
54 0.06
55 0.06
56 0.07
57 0.08
58 0.1
59 0.14
60 0.15
61 0.15
62 0.19
63 0.23
64 0.25
65 0.33
66 0.31
67 0.28
68 0.3
69 0.3
70 0.27
71 0.25
72 0.23
73 0.14
74 0.14
75 0.13
76 0.11
77 0.09
78 0.08
79 0.08
80 0.08
81 0.07
82 0.08
83 0.08
84 0.09
85 0.09
86 0.08
87 0.07
88 0.08
89 0.07
90 0.08
91 0.09
92 0.09
93 0.1
94 0.12
95 0.13
96 0.12
97 0.13
98 0.13
99 0.12
100 0.13
101 0.14
102 0.21
103 0.23
104 0.28
105 0.3
106 0.3
107 0.29
108 0.29
109 0.31
110 0.24
111 0.22
112 0.17
113 0.19
114 0.21
115 0.25
116 0.27
117 0.27
118 0.27
119 0.29
120 0.31
121 0.29
122 0.28
123 0.26
124 0.23
125 0.2
126 0.19
127 0.17
128 0.19
129 0.16
130 0.17
131 0.14
132 0.13
133 0.13
134 0.11
135 0.11
136 0.07
137 0.07
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.07
148 0.1
149 0.12
150 0.17
151 0.21
152 0.27
153 0.36
154 0.42
155 0.46
156 0.51
157 0.53
158 0.54
159 0.56
160 0.58
161 0.6
162 0.62
163 0.62
164 0.57
165 0.53
166 0.49
167 0.43
168 0.38
169 0.3
170 0.23
171 0.18
172 0.23
173 0.31
174 0.33
175 0.42
176 0.45
177 0.53
178 0.55
179 0.6
180 0.58
181 0.57
182 0.54
183 0.48
184 0.47
185 0.38
186 0.39
187 0.41
188 0.38
189 0.34
190 0.34
191 0.33
192 0.31
193 0.32
194 0.31
195 0.33
196 0.37
197 0.39
198 0.45