Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NZ35

Protein Details
Accession A0A1E3NZ35    Localization Confidence High Confidence Score 19.7
NoLS Segment(s)
PositionSequenceProtein Nature
111-130DQIRRAHRKQVLKHHPDKKABasic
282-306IKLFKEADKKEKERKKWERDAGAREBasic
334-362ADSKKAKEAAKSAKKKNKRAVRGAAKEAGHydrophilic
NLS Segment(s)
PositionSequence
250-262ERKNVAARKKRKT
278-358EDPRIKLFKEADKKEKERKKWERDAGAREAAAKAKKEAEEAAAKKEAEEAAAAAAKADSKKAKEAAKSAKKKNKRAVRGAA
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR036869  J_dom_sf  
IPR032003  RAC_head  
IPR042569  RAC_head_sf  
IPR044634  Zuotin/DnaJC2  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0030544  F:Hsp70 protein binding  
GO:0043022  F:ribosome binding  
GO:0051083  P:'de novo' cotranslational protein folding  
GO:0006450  P:regulation of translational fidelity  
Pfam View protein in Pfam  
PF00226  DnaJ  
PF16717  RAC_head  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MSLPSLPANFGAENFKASAKYTAPVRRPIEPVGRYFLAHASRALRGHTWSEFEKIEAEKNVSKVDETNEDADLGDEEQDAELLAHDPRDWKSADLYAVMGISHLRHKATEDQIRRAHRKQVLKHHPDKKAGSGGLDQDGFFKIIQKAYECLLDPTKRLQYDSVDENANVEPPALKSNYDFFEAWGPVIASEARFSKKQPVPLLGDINTPKQEVESFYAFWYRIDSWRTFEFLDEDVPDDSSNRDHKRYIERKNVAARKKRKTEDNARLLALVDRVKAEDPRIKLFKEADKKEKERKKWERDAGAREAAAKAKKEAEEAAAKKEAEEAAAAAAKADSKKAKEAAKSAKKKNKRAVRGAAKEAGYFGDADKAEAIDADVALLIENFDDLQLSSVAGTVASGDAAAIKSTLSEIAKEQASSGKVPAAALKYFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.21
5 0.24
6 0.2
7 0.24
8 0.3
9 0.38
10 0.42
11 0.5
12 0.52
13 0.53
14 0.55
15 0.58
16 0.6
17 0.54
18 0.52
19 0.5
20 0.48
21 0.42
22 0.4
23 0.39
24 0.32
25 0.29
26 0.29
27 0.25
28 0.28
29 0.29
30 0.3
31 0.26
32 0.26
33 0.29
34 0.28
35 0.29
36 0.27
37 0.3
38 0.28
39 0.26
40 0.27
41 0.24
42 0.27
43 0.26
44 0.29
45 0.28
46 0.29
47 0.31
48 0.28
49 0.27
50 0.25
51 0.25
52 0.26
53 0.25
54 0.25
55 0.23
56 0.23
57 0.21
58 0.19
59 0.16
60 0.12
61 0.09
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.05
68 0.05
69 0.06
70 0.07
71 0.07
72 0.08
73 0.11
74 0.12
75 0.16
76 0.16
77 0.16
78 0.18
79 0.2
80 0.21
81 0.19
82 0.17
83 0.15
84 0.14
85 0.12
86 0.1
87 0.07
88 0.08
89 0.1
90 0.12
91 0.12
92 0.12
93 0.15
94 0.22
95 0.3
96 0.39
97 0.4
98 0.47
99 0.53
100 0.61
101 0.65
102 0.62
103 0.62
104 0.6
105 0.63
106 0.63
107 0.68
108 0.71
109 0.74
110 0.8
111 0.8
112 0.8
113 0.79
114 0.73
115 0.66
116 0.61
117 0.52
118 0.44
119 0.37
120 0.32
121 0.27
122 0.26
123 0.21
124 0.16
125 0.16
126 0.15
127 0.12
128 0.14
129 0.13
130 0.14
131 0.15
132 0.15
133 0.16
134 0.16
135 0.18
136 0.15
137 0.16
138 0.2
139 0.2
140 0.2
141 0.24
142 0.28
143 0.26
144 0.27
145 0.26
146 0.23
147 0.26
148 0.27
149 0.25
150 0.21
151 0.21
152 0.21
153 0.19
154 0.17
155 0.13
156 0.1
157 0.08
158 0.08
159 0.11
160 0.1
161 0.1
162 0.1
163 0.14
164 0.15
165 0.18
166 0.17
167 0.15
168 0.18
169 0.18
170 0.17
171 0.14
172 0.12
173 0.09
174 0.09
175 0.09
176 0.05
177 0.06
178 0.09
179 0.1
180 0.11
181 0.12
182 0.21
183 0.24
184 0.29
185 0.31
186 0.33
187 0.36
188 0.38
189 0.4
190 0.31
191 0.32
192 0.28
193 0.27
194 0.23
195 0.19
196 0.15
197 0.13
198 0.13
199 0.11
200 0.13
201 0.13
202 0.13
203 0.13
204 0.15
205 0.14
206 0.13
207 0.14
208 0.12
209 0.13
210 0.16
211 0.16
212 0.18
213 0.18
214 0.2
215 0.18
216 0.17
217 0.16
218 0.13
219 0.13
220 0.11
221 0.11
222 0.09
223 0.1
224 0.09
225 0.08
226 0.08
227 0.1
228 0.17
229 0.18
230 0.2
231 0.21
232 0.26
233 0.37
234 0.45
235 0.51
236 0.55
237 0.55
238 0.59
239 0.67
240 0.71
241 0.68
242 0.69
243 0.7
244 0.69
245 0.75
246 0.73
247 0.72
248 0.74
249 0.76
250 0.77
251 0.76
252 0.69
253 0.6
254 0.56
255 0.47
256 0.39
257 0.31
258 0.22
259 0.14
260 0.11
261 0.12
262 0.13
263 0.13
264 0.16
265 0.18
266 0.2
267 0.26
268 0.29
269 0.28
270 0.31
271 0.33
272 0.38
273 0.42
274 0.47
275 0.49
276 0.55
277 0.61
278 0.69
279 0.74
280 0.74
281 0.76
282 0.8
283 0.81
284 0.82
285 0.84
286 0.84
287 0.82
288 0.8
289 0.74
290 0.66
291 0.56
292 0.47
293 0.4
294 0.35
295 0.31
296 0.25
297 0.21
298 0.23
299 0.23
300 0.23
301 0.23
302 0.23
303 0.28
304 0.28
305 0.31
306 0.31
307 0.3
308 0.29
309 0.3
310 0.25
311 0.17
312 0.16
313 0.11
314 0.09
315 0.1
316 0.1
317 0.08
318 0.08
319 0.1
320 0.1
321 0.14
322 0.16
323 0.17
324 0.23
325 0.28
326 0.33
327 0.36
328 0.44
329 0.51
330 0.58
331 0.65
332 0.71
333 0.76
334 0.8
335 0.86
336 0.87
337 0.87
338 0.86
339 0.86
340 0.86
341 0.87
342 0.85
343 0.81
344 0.77
345 0.68
346 0.58
347 0.49
348 0.39
349 0.28
350 0.21
351 0.15
352 0.15
353 0.14
354 0.14
355 0.14
356 0.13
357 0.12
358 0.12
359 0.12
360 0.07
361 0.06
362 0.06
363 0.05
364 0.05
365 0.05
366 0.05
367 0.05
368 0.04
369 0.04
370 0.04
371 0.04
372 0.04
373 0.04
374 0.06
375 0.06
376 0.07
377 0.06
378 0.07
379 0.07
380 0.06
381 0.06
382 0.05
383 0.05
384 0.05
385 0.04
386 0.04
387 0.05
388 0.06
389 0.07
390 0.06
391 0.06
392 0.06
393 0.07
394 0.12
395 0.11
396 0.12
397 0.14
398 0.19
399 0.21
400 0.2
401 0.21
402 0.22
403 0.24
404 0.24
405 0.24
406 0.22
407 0.21
408 0.22
409 0.26
410 0.24