Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P9T8

Protein Details
Accession A0A1E3P9T8   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-94QTLRKIAHIRPYRNKFKKRTQDMNDIDKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MALVMAHGRALGILYKAMDLRGFNNIIKERNEMLFKAFPSRYIDLDSEIIHKYAENSVRLVKEEMTQTLRKIAHIRPYRNKFKKRTQDMNDIDKVYYELYCIKQSIKNRDDHANN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.1
4 0.11
5 0.12
6 0.11
7 0.12
8 0.16
9 0.18
10 0.17
11 0.24
12 0.26
13 0.28
14 0.29
15 0.31
16 0.29
17 0.3
18 0.31
19 0.25
20 0.26
21 0.25
22 0.24
23 0.27
24 0.25
25 0.24
26 0.27
27 0.29
28 0.25
29 0.25
30 0.25
31 0.2
32 0.21
33 0.2
34 0.16
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.12
41 0.14
42 0.13
43 0.13
44 0.16
45 0.16
46 0.17
47 0.17
48 0.14
49 0.13
50 0.14
51 0.15
52 0.17
53 0.18
54 0.17
55 0.22
56 0.21
57 0.21
58 0.24
59 0.25
60 0.3
61 0.38
62 0.45
63 0.5
64 0.59
65 0.69
66 0.74
67 0.8
68 0.79
69 0.82
70 0.84
71 0.84
72 0.86
73 0.82
74 0.83
75 0.8
76 0.8
77 0.74
78 0.64
79 0.54
80 0.44
81 0.38
82 0.28
83 0.21
84 0.15
85 0.14
86 0.15
87 0.18
88 0.18
89 0.21
90 0.26
91 0.34
92 0.43
93 0.45
94 0.49
95 0.51