Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3P889

Protein Details
Accession A0A1E3P889    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRQLRKERKERERREMMARSBasic
NLS Segment(s)
PositionSequence
6-14RKERKERER
Subcellular Location(s) nucl 18.5, cyto_nucl 10.833, mito 4, cyto_pero 2.333, cyto 2
Family & Domain DBs
Amino Acid Sequences MKRQLRKERKERERREMMARSGDVDQGAISQDNTNFDSLDDEDGETPIGGDEVDDVDINDLRYDIDNPAIEQYVLSGNSNDINVYDENINFEEQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.79
4 0.72
5 0.67
6 0.58
7 0.5
8 0.42
9 0.37
10 0.28
11 0.21
12 0.16
13 0.1
14 0.1
15 0.08
16 0.07
17 0.08
18 0.08
19 0.11
20 0.12
21 0.12
22 0.11
23 0.1
24 0.11
25 0.11
26 0.11
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.06
33 0.05
34 0.04
35 0.04
36 0.03
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.08
51 0.08
52 0.1
53 0.1
54 0.11
55 0.12
56 0.12
57 0.11
58 0.1
59 0.1
60 0.1
61 0.11
62 0.11
63 0.1
64 0.1
65 0.11
66 0.12
67 0.11
68 0.08
69 0.11
70 0.1
71 0.12
72 0.14
73 0.13
74 0.16
75 0.17