Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3P736

Protein Details
Accession A0A1E3P736    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
84-108EYSCRQFYKYRERRNNKGNARNNIGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, plas 7, E.R. 3, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSVVLIGISIVLQLFSAPSYDLQKVSAAVALFISNVISNVTVVKMVHSFQNHYGRNGISAQVGKRYFALVWTAFALLVFSALFEYSCRQFYKYRERRNNKGNARNNIGERVVDQEKGFNSEQTSNAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.06
5 0.08
6 0.12
7 0.13
8 0.14
9 0.15
10 0.15
11 0.15
12 0.15
13 0.15
14 0.11
15 0.1
16 0.1
17 0.09
18 0.08
19 0.07
20 0.07
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.06
29 0.06
30 0.07
31 0.08
32 0.08
33 0.11
34 0.12
35 0.14
36 0.19
37 0.29
38 0.29
39 0.29
40 0.3
41 0.27
42 0.27
43 0.26
44 0.2
45 0.12
46 0.13
47 0.13
48 0.17
49 0.17
50 0.16
51 0.15
52 0.15
53 0.13
54 0.12
55 0.15
56 0.09
57 0.09
58 0.1
59 0.1
60 0.09
61 0.09
62 0.08
63 0.05
64 0.05
65 0.04
66 0.03
67 0.03
68 0.03
69 0.04
70 0.04
71 0.07
72 0.08
73 0.11
74 0.12
75 0.15
76 0.19
77 0.26
78 0.37
79 0.45
80 0.55
81 0.63
82 0.7
83 0.77
84 0.82
85 0.86
86 0.85
87 0.85
88 0.84
89 0.81
90 0.8
91 0.76
92 0.7
93 0.64
94 0.54
95 0.44
96 0.36
97 0.34
98 0.29
99 0.25
100 0.23
101 0.22
102 0.22
103 0.27
104 0.27
105 0.23
106 0.25
107 0.26