Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NXC6

Protein Details
Accession A0A1E3NXC6   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHQKKFKRHHSDRYNRVAENHydrophilic
NLS Segment(s)
PositionSequence
9-22KIVKKHQKKFKRHH
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHQKKFKRHHSDRYNRVAENWRKQKGIDSCVRRRFRGTIPQPNIGYGSNRRTRHLMPSGHKAFLVNNVKDLDLLLLHTKTYAAEISHSVSSKNRIEILARAKALGLKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.81
3 0.89
4 0.92
5 0.93
6 0.93
7 0.91
8 0.91
9 0.92
10 0.92
11 0.91
12 0.9
13 0.84
14 0.73
15 0.69
16 0.68
17 0.66
18 0.66
19 0.66
20 0.59
21 0.54
22 0.54
23 0.58
24 0.54
25 0.52
26 0.5
27 0.5
28 0.55
29 0.64
30 0.68
31 0.61
32 0.58
33 0.55
34 0.52
35 0.54
36 0.53
37 0.54
38 0.55
39 0.6
40 0.56
41 0.52
42 0.48
43 0.38
44 0.32
45 0.25
46 0.27
47 0.29
48 0.3
49 0.31
50 0.33
51 0.33
52 0.37
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.41
60 0.34
61 0.28
62 0.31
63 0.34
64 0.25
65 0.25
66 0.25
67 0.25
68 0.24
69 0.24
70 0.15
71 0.08
72 0.09
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.09
80 0.09
81 0.07
82 0.08
83 0.1
84 0.12
85 0.15
86 0.15
87 0.15
88 0.16
89 0.22
90 0.23
91 0.24
92 0.23
93 0.22
94 0.24
95 0.29
96 0.34
97 0.34
98 0.32
99 0.3
100 0.29
101 0.3
102 0.29
103 0.27
104 0.21
105 0.2
106 0.29
107 0.37
108 0.42
109 0.41
110 0.43
111 0.42