Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NZ92

Protein Details
Accession A0A1E3NZ92   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-44APETTKKVTKTQKKKFEVRKWTAVAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14, cyto 13.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR024766  Znf_RING_H2  
Gene Ontology GO:0008270  F:zinc ion binding  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF12678  zf-rbx1  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16485  mRING-H2-C3H2C2D_RBX1  
Amino Acid Sequences MSDLMDVDVPRETPEQEVVAPETTKKVTKTQKKKFEVRKWTAVAFWSWDIVVETCAICRNHLMEPCIECQPNSMSATSNECIAAWGACNHAFHMHCISRWLKTRNVCPLDNREWQFQKYGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.18
5 0.17
6 0.19
7 0.18
8 0.17
9 0.18
10 0.18
11 0.21
12 0.21
13 0.28
14 0.35
15 0.46
16 0.56
17 0.64
18 0.72
19 0.77
20 0.85
21 0.87
22 0.87
23 0.87
24 0.83
25 0.81
26 0.73
27 0.66
28 0.57
29 0.47
30 0.38
31 0.29
32 0.23
33 0.15
34 0.11
35 0.11
36 0.1
37 0.09
38 0.09
39 0.06
40 0.06
41 0.06
42 0.1
43 0.1
44 0.09
45 0.1
46 0.11
47 0.13
48 0.15
49 0.16
50 0.14
51 0.16
52 0.18
53 0.2
54 0.18
55 0.15
56 0.15
57 0.15
58 0.16
59 0.16
60 0.14
61 0.12
62 0.14
63 0.18
64 0.17
65 0.16
66 0.13
67 0.12
68 0.12
69 0.11
70 0.1
71 0.06
72 0.07
73 0.08
74 0.1
75 0.11
76 0.11
77 0.15
78 0.15
79 0.16
80 0.23
81 0.22
82 0.21
83 0.26
84 0.27
85 0.29
86 0.36
87 0.38
88 0.38
89 0.44
90 0.51
91 0.57
92 0.6
93 0.57
94 0.56
95 0.61
96 0.61
97 0.63
98 0.6
99 0.58
100 0.57
101 0.56