Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3NW32

Protein Details
Accession A0A1E3NW32    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
114-134HGLHRPIKMKRGVIKRRKRNPBasic
NLS Segment(s)
PositionSequence
118-134RPIKMKRGVIKRRKRNP
Subcellular Location(s) nucl 18, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MSSTQSPNNQSASPPNICAVTSPNTQSTAQVCSNCATTKTPLWRRAPDGLLICNACGLYYRANNSHLGSVIGAEQIGNVAIACTNCGTTVTPLWRRDDNGDTICNACGLYYRLHGLHRPIKMKRGVIKRRKRNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.28
4 0.27
5 0.25
6 0.22
7 0.21
8 0.21
9 0.23
10 0.23
11 0.25
12 0.26
13 0.27
14 0.25
15 0.25
16 0.25
17 0.23
18 0.23
19 0.21
20 0.23
21 0.21
22 0.22
23 0.19
24 0.19
25 0.23
26 0.32
27 0.39
28 0.45
29 0.5
30 0.52
31 0.54
32 0.56
33 0.52
34 0.46
35 0.4
36 0.33
37 0.3
38 0.26
39 0.21
40 0.16
41 0.14
42 0.1
43 0.09
44 0.08
45 0.09
46 0.1
47 0.13
48 0.14
49 0.16
50 0.17
51 0.17
52 0.16
53 0.14
54 0.12
55 0.1
56 0.09
57 0.07
58 0.06
59 0.05
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.02
66 0.02
67 0.03
68 0.03
69 0.04
70 0.04
71 0.05
72 0.05
73 0.06
74 0.07
75 0.08
76 0.11
77 0.17
78 0.24
79 0.26
80 0.3
81 0.31
82 0.32
83 0.35
84 0.36
85 0.35
86 0.32
87 0.3
88 0.28
89 0.27
90 0.25
91 0.21
92 0.17
93 0.11
94 0.1
95 0.1
96 0.11
97 0.12
98 0.15
99 0.16
100 0.19
101 0.22
102 0.28
103 0.33
104 0.38
105 0.45
106 0.46
107 0.52
108 0.57
109 0.6
110 0.62
111 0.66
112 0.7
113 0.73
114 0.8