Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PBS8

Protein Details
Accession A0A1E3PBS8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21PIIKRLPKSMKKYGKRFVNAPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 5, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018811  Mrx11  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10306  FLILHELTA  
Amino Acid Sequences PIIKRLPKSMKKYGKRFVNAPVSHLTAFVILHELTALVPFLGLWYGFHQFGFLPTDIPSWVLIKGSGVIEHILGETAQNYSVEERTRLIVEGATAYGIVKATFPVRVFISLFMTPWFARVFVLPMKNLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.75
4 0.73
5 0.73
6 0.63
7 0.57
8 0.51
9 0.45
10 0.39
11 0.36
12 0.27
13 0.17
14 0.17
15 0.13
16 0.12
17 0.08
18 0.08
19 0.07
20 0.07
21 0.06
22 0.06
23 0.06
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.04
31 0.06
32 0.08
33 0.09
34 0.09
35 0.09
36 0.09
37 0.1
38 0.13
39 0.11
40 0.09
41 0.1
42 0.11
43 0.1
44 0.11
45 0.1
46 0.08
47 0.08
48 0.07
49 0.06
50 0.06
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.06
68 0.08
69 0.09
70 0.1
71 0.11
72 0.11
73 0.12
74 0.12
75 0.11
76 0.1
77 0.09
78 0.09
79 0.08
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.06
88 0.07
89 0.11
90 0.11
91 0.13
92 0.14
93 0.16
94 0.17
95 0.17
96 0.21
97 0.18
98 0.18
99 0.17
100 0.19
101 0.16
102 0.18
103 0.17
104 0.12
105 0.13
106 0.13
107 0.16
108 0.19
109 0.23