Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3BBT5

Protein Details
Accession G3BBT5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASIPHPKIVKKHTKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
9-25KIVKKHTKKFKRHHSDR
Subcellular Location(s) mito 15.5, mito_nucl 13.333, nucl 10, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cten:CANTEDRAFT_95124  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASIPHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSVVRRRFRGNISEPNIGYGSNNKTKFLMPSGHKAYLVKNLKDLDVLLMHTKTYAAEIAHNVSAKNRVDIIEKAKKLGVKVTNPKGRVSLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.91
13 0.86
14 0.76
15 0.71
16 0.71
17 0.7
18 0.7
19 0.7
20 0.64
21 0.58
22 0.58
23 0.61
24 0.57
25 0.53
26 0.5
27 0.49
28 0.56
29 0.64
30 0.67
31 0.6
32 0.55
33 0.51
34 0.47
35 0.46
36 0.43
37 0.43
38 0.44
39 0.48
40 0.46
41 0.44
42 0.41
43 0.32
44 0.26
45 0.2
46 0.2
47 0.22
48 0.23
49 0.21
50 0.22
51 0.23
52 0.24
53 0.22
54 0.24
55 0.19
56 0.26
57 0.3
58 0.3
59 0.3
60 0.3
61 0.29
62 0.32
63 0.36
64 0.28
65 0.28
66 0.27
67 0.27
68 0.27
69 0.25
70 0.17
71 0.12
72 0.13
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.08
79 0.08
80 0.09
81 0.07
82 0.09
83 0.1
84 0.13
85 0.15
86 0.16
87 0.15
88 0.15
89 0.21
90 0.2
91 0.2
92 0.18
93 0.18
94 0.21
95 0.25
96 0.32
97 0.36
98 0.36
99 0.36
100 0.37
101 0.38
102 0.36
103 0.4
104 0.39
105 0.39
106 0.49
107 0.57
108 0.63
109 0.62
110 0.63
111 0.59