Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3P425

Protein Details
Accession A0A1E3P425    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
48-76KADPAKYQKKLMRQRNRKNIKHNNFMAQMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 12, cyto 4.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences IKSSCPVGTLLNLKIKKSGAEPVALEDHEYPEWLWTVLDPKAQEEKLKADPAKYQKKLMRQRNRKNIKHNNFMAQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.3
4 0.28
5 0.3
6 0.23
7 0.24
8 0.24
9 0.24
10 0.25
11 0.24
12 0.23
13 0.16
14 0.16
15 0.13
16 0.14
17 0.11
18 0.09
19 0.09
20 0.08
21 0.07
22 0.05
23 0.08
24 0.08
25 0.1
26 0.1
27 0.11
28 0.15
29 0.16
30 0.17
31 0.16
32 0.2
33 0.22
34 0.28
35 0.27
36 0.25
37 0.31
38 0.4
39 0.48
40 0.47
41 0.51
42 0.49
43 0.59
44 0.68
45 0.72
46 0.73
47 0.74
48 0.83
49 0.86
50 0.92
51 0.9
52 0.91
53 0.92
54 0.9
55 0.89
56 0.83