Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NUD6

Protein Details
Accession A0A1E3NUD6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-75KPFVCTTCTKKFKRPQDLKKHVKTHADHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 7, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MLYNHLCDDHVGRKSNRNLNLNCAWDGCQVQTVKRDHITSHIRVHIPLKPFVCTTCTKKFKRPQDLKKHVKTHAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.6
4 0.61
5 0.57
6 0.57
7 0.6
8 0.54
9 0.47
10 0.4
11 0.34
12 0.27
13 0.26
14 0.19
15 0.18
16 0.16
17 0.17
18 0.22
19 0.22
20 0.23
21 0.24
22 0.25
23 0.2
24 0.27
25 0.31
26 0.28
27 0.3
28 0.32
29 0.3
30 0.3
31 0.33
32 0.3
33 0.27
34 0.28
35 0.25
36 0.23
37 0.23
38 0.23
39 0.25
40 0.26
41 0.3
42 0.35
43 0.44
44 0.46
45 0.56
46 0.65
47 0.71
48 0.78
49 0.82
50 0.82
51 0.85
52 0.91
53 0.92
54 0.92
55 0.9