Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3NY86

Protein Details
Accession A0A1E3NY86   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
117-137AEWVAKNKKVSDEKKRRKIHLBasic
NLS Segment(s)
PositionSequence
123-135NKKVSDEKKRRKI
Subcellular Location(s) nucl 7.5, extr 7, cyto_nucl 6, E.R. 4, cyto 3.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018937  MMgT  
Gene Ontology GO:0016020  C:membrane  
GO:0051234  P:establishment of localization  
Pfam View protein in Pfam  
PF10270  MMgT  
Amino Acid Sequences MKLLKIIGLGSLLHAGYSSYEYTHSQKAHNTSIPFPQDIILEVIISLLILSLDLLFSSNQPKLSLINNDVVKSQFKLKPILMKDAVVEDEKLGAGPFQFVESKVFFTDFAQKRKDYAEWVAKNKKVSDEKKRRKIHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.1
5 0.1
6 0.08
7 0.1
8 0.14
9 0.17
10 0.23
11 0.24
12 0.24
13 0.29
14 0.34
15 0.38
16 0.4
17 0.39
18 0.35
19 0.41
20 0.41
21 0.36
22 0.31
23 0.26
24 0.22
25 0.2
26 0.19
27 0.12
28 0.09
29 0.08
30 0.07
31 0.06
32 0.06
33 0.04
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.03
42 0.03
43 0.04
44 0.07
45 0.09
46 0.09
47 0.1
48 0.11
49 0.11
50 0.14
51 0.16
52 0.15
53 0.19
54 0.2
55 0.2
56 0.2
57 0.2
58 0.18
59 0.16
60 0.2
61 0.17
62 0.18
63 0.21
64 0.22
65 0.28
66 0.29
67 0.34
68 0.29
69 0.27
70 0.26
71 0.24
72 0.24
73 0.18
74 0.16
75 0.09
76 0.09
77 0.08
78 0.08
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.07
86 0.08
87 0.11
88 0.12
89 0.14
90 0.14
91 0.14
92 0.13
93 0.14
94 0.24
95 0.27
96 0.32
97 0.35
98 0.35
99 0.36
100 0.39
101 0.39
102 0.33
103 0.36
104 0.41
105 0.44
106 0.53
107 0.6
108 0.6
109 0.62
110 0.6
111 0.6
112 0.6
113 0.62
114 0.64
115 0.67
116 0.75
117 0.81