Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3PC82

Protein Details
Accession A0A1E3PC82   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
75-94YLKYLTKRYLKKNQIRDWIRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 10, mito 5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPITNKKAKAAKKFTVDVSAPTENGVFDPSSYTKYLNDHIKVEGAVGNLGNDITVEENGTTITVVSTTKFSGKYLKYLTKRYLKKNQIRDWIRFVSVKQGVYKLTFYSVAADEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.62
3 0.61
4 0.54
5 0.46
6 0.43
7 0.37
8 0.3
9 0.27
10 0.25
11 0.18
12 0.17
13 0.15
14 0.09
15 0.07
16 0.11
17 0.11
18 0.14
19 0.15
20 0.15
21 0.15
22 0.18
23 0.23
24 0.27
25 0.28
26 0.27
27 0.27
28 0.26
29 0.25
30 0.23
31 0.19
32 0.12
33 0.1
34 0.08
35 0.08
36 0.07
37 0.06
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.04
53 0.04
54 0.05
55 0.06
56 0.08
57 0.09
58 0.1
59 0.16
60 0.17
61 0.22
62 0.27
63 0.35
64 0.38
65 0.43
66 0.5
67 0.53
68 0.59
69 0.63
70 0.68
71 0.69
72 0.74
73 0.78
74 0.79
75 0.8
76 0.79
77 0.75
78 0.71
79 0.64
80 0.58
81 0.5
82 0.42
83 0.41
84 0.39
85 0.37
86 0.32
87 0.31
88 0.3
89 0.31
90 0.32
91 0.24
92 0.22
93 0.21
94 0.18
95 0.2
96 0.19
97 0.18
98 0.17