Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7YJ20

Protein Details
Accession C7YJ20    Localization Confidence High Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
408-447EAMARSKAKGSKKRKSTPQPASTKAPRPPKPPPAPKTPEPHydrophilic
495-518EYRDEDTLKARARKKRRDRRRSKQBasic
NLS Segment(s)
PositionSequence
358-363RRKQEK
411-474ARSKAKGSKKRKSTPQPASTKAPRPPKPPPAPKTPEPPKEFKSFFSKKYERESALHRHRRTGRK
503-518KARARKKRRDRRRSKQ
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038988  Sas4  
IPR029184  Sas4_dom  
Gene Ontology GO:0033255  C:SAS acetyltransferase complex  
GO:0016573  P:histone acetylation  
KEGG nhe:NECHADRAFT_75525  -  
Pfam View protein in Pfam  
PF15460  SAS4  
Amino Acid Sequences MASVTRSSRRAEGPHPHQHLAHHHLTPSTSVFAHTQGGAGGGGGRSKRVLDAHDRDRDALKPKRTRITVEILAKGSHGLSDIIPDNIVPPPARNPRQTATPTVASATTTPATNPPPSTEVAKPAPKQEPTLTKHQSKVINGIKHELDRLQPQAKDTNPQEQGRKLRSQEATRFKSELSAYFPEYDEVIGNEPKEQHLFNVDTPIVVVDSDPRRAVSGAQRAAPQQPHPADEYPVRGYGDALFHDVFDAQRVELNFLVQPKDKTVEDPLPDKLFQPVHRRAERLERSIRNTEKGRAQHEKDQIIRLLEGLQGHDWLRVMGVSGVTETKKKTFEPARDHFIKGCQAILAKFRNWVLEEKRRKQEKDKARAEKEDEEDSGSADEEDEADDHDGANGDTSDSASPAKQLRDEAMARSKAKGSKKRKSTPQPASTKAPRPPKPPPAPKTPEPPKEFKSFFSKKYERESALHRHRRTGRKVLAWGHPIPEIPQVDFDLPEEYRDEDTLKARARKKRRDRRRSKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.69
3 0.67
4 0.63
5 0.62
6 0.62
7 0.59
8 0.56
9 0.48
10 0.43
11 0.41
12 0.41
13 0.38
14 0.32
15 0.26
16 0.2
17 0.2
18 0.19
19 0.19
20 0.2
21 0.18
22 0.16
23 0.13
24 0.13
25 0.11
26 0.1
27 0.09
28 0.08
29 0.11
30 0.11
31 0.12
32 0.12
33 0.13
34 0.16
35 0.17
36 0.22
37 0.29
38 0.37
39 0.45
40 0.52
41 0.53
42 0.52
43 0.52
44 0.52
45 0.52
46 0.52
47 0.53
48 0.54
49 0.59
50 0.67
51 0.68
52 0.68
53 0.64
54 0.65
55 0.63
56 0.6
57 0.57
58 0.49
59 0.46
60 0.4
61 0.35
62 0.27
63 0.18
64 0.13
65 0.09
66 0.08
67 0.12
68 0.13
69 0.12
70 0.12
71 0.12
72 0.12
73 0.13
74 0.15
75 0.11
76 0.12
77 0.21
78 0.31
79 0.37
80 0.4
81 0.44
82 0.45
83 0.53
84 0.55
85 0.51
86 0.47
87 0.44
88 0.4
89 0.36
90 0.33
91 0.25
92 0.22
93 0.2
94 0.15
95 0.13
96 0.13
97 0.16
98 0.19
99 0.21
100 0.22
101 0.21
102 0.23
103 0.24
104 0.28
105 0.26
106 0.28
107 0.32
108 0.38
109 0.37
110 0.41
111 0.46
112 0.43
113 0.46
114 0.46
115 0.49
116 0.46
117 0.54
118 0.55
119 0.53
120 0.54
121 0.56
122 0.55
123 0.47
124 0.53
125 0.5
126 0.48
127 0.44
128 0.45
129 0.41
130 0.37
131 0.37
132 0.29
133 0.24
134 0.23
135 0.28
136 0.29
137 0.27
138 0.29
139 0.33
140 0.32
141 0.37
142 0.36
143 0.39
144 0.4
145 0.43
146 0.45
147 0.46
148 0.52
149 0.5
150 0.54
151 0.47
152 0.48
153 0.5
154 0.54
155 0.56
156 0.59
157 0.58
158 0.55
159 0.54
160 0.46
161 0.44
162 0.38
163 0.31
164 0.27
165 0.24
166 0.23
167 0.23
168 0.24
169 0.2
170 0.19
171 0.17
172 0.11
173 0.09
174 0.1
175 0.1
176 0.1
177 0.11
178 0.11
179 0.12
180 0.13
181 0.13
182 0.11
183 0.14
184 0.15
185 0.14
186 0.18
187 0.17
188 0.15
189 0.15
190 0.15
191 0.1
192 0.08
193 0.08
194 0.09
195 0.11
196 0.13
197 0.13
198 0.13
199 0.14
200 0.14
201 0.17
202 0.18
203 0.24
204 0.25
205 0.26
206 0.27
207 0.28
208 0.31
209 0.31
210 0.26
211 0.25
212 0.24
213 0.24
214 0.25
215 0.25
216 0.24
217 0.23
218 0.25
219 0.19
220 0.2
221 0.18
222 0.15
223 0.15
224 0.14
225 0.13
226 0.1
227 0.11
228 0.1
229 0.09
230 0.09
231 0.09
232 0.08
233 0.08
234 0.08
235 0.05
236 0.07
237 0.08
238 0.09
239 0.09
240 0.1
241 0.09
242 0.1
243 0.12
244 0.12
245 0.12
246 0.12
247 0.15
248 0.14
249 0.14
250 0.17
251 0.2
252 0.2
253 0.22
254 0.23
255 0.23
256 0.23
257 0.22
258 0.21
259 0.19
260 0.22
261 0.29
262 0.34
263 0.4
264 0.42
265 0.43
266 0.42
267 0.49
268 0.49
269 0.47
270 0.48
271 0.44
272 0.47
273 0.54
274 0.54
275 0.49
276 0.46
277 0.44
278 0.41
279 0.42
280 0.43
281 0.43
282 0.45
283 0.47
284 0.51
285 0.52
286 0.47
287 0.46
288 0.42
289 0.34
290 0.31
291 0.23
292 0.18
293 0.14
294 0.13
295 0.11
296 0.09
297 0.09
298 0.1
299 0.1
300 0.09
301 0.07
302 0.07
303 0.06
304 0.06
305 0.05
306 0.05
307 0.05
308 0.05
309 0.07
310 0.08
311 0.1
312 0.11
313 0.13
314 0.15
315 0.15
316 0.23
317 0.29
318 0.36
319 0.44
320 0.47
321 0.53
322 0.54
323 0.55
324 0.48
325 0.44
326 0.4
327 0.31
328 0.26
329 0.19
330 0.17
331 0.17
332 0.22
333 0.22
334 0.19
335 0.21
336 0.21
337 0.23
338 0.23
339 0.28
340 0.3
341 0.37
342 0.46
343 0.52
344 0.62
345 0.67
346 0.7
347 0.73
348 0.75
349 0.75
350 0.76
351 0.78
352 0.79
353 0.77
354 0.79
355 0.75
356 0.71
357 0.64
358 0.57
359 0.47
360 0.39
361 0.33
362 0.27
363 0.22
364 0.16
365 0.12
366 0.09
367 0.08
368 0.05
369 0.06
370 0.05
371 0.06
372 0.07
373 0.07
374 0.06
375 0.07
376 0.07
377 0.07
378 0.07
379 0.06
380 0.06
381 0.06
382 0.07
383 0.07
384 0.07
385 0.08
386 0.08
387 0.11
388 0.15
389 0.16
390 0.17
391 0.19
392 0.2
393 0.25
394 0.27
395 0.29
396 0.33
397 0.37
398 0.37
399 0.37
400 0.4
401 0.4
402 0.49
403 0.54
404 0.56
405 0.6
406 0.7
407 0.77
408 0.83
409 0.88
410 0.89
411 0.9
412 0.89
413 0.88
414 0.83
415 0.82
416 0.8
417 0.77
418 0.74
419 0.74
420 0.71
421 0.7
422 0.74
423 0.76
424 0.79
425 0.81
426 0.79
427 0.8
428 0.81
429 0.79
430 0.8
431 0.79
432 0.78
433 0.74
434 0.75
435 0.7
436 0.71
437 0.67
438 0.6
439 0.6
440 0.57
441 0.56
442 0.59
443 0.61
444 0.58
445 0.65
446 0.69
447 0.63
448 0.6
449 0.62
450 0.62
451 0.66
452 0.71
453 0.64
454 0.66
455 0.71
456 0.77
457 0.78
458 0.77
459 0.75
460 0.72
461 0.78
462 0.75
463 0.74
464 0.71
465 0.64
466 0.56
467 0.49
468 0.42
469 0.36
470 0.36
471 0.3
472 0.24
473 0.24
474 0.25
475 0.24
476 0.24
477 0.23
478 0.2
479 0.19
480 0.19
481 0.18
482 0.18
483 0.18
484 0.19
485 0.2
486 0.19
487 0.22
488 0.28
489 0.35
490 0.41
491 0.47
492 0.56
493 0.65
494 0.73
495 0.81
496 0.85
497 0.88
498 0.92