Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9HTY6

Protein Details
Accession A0A1B9HTY6   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
15-47RSQAPKVEKQEKKKTPKGRAKKRLQYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
11-38AGKVRSQAPKVEKQEKKKTPKGRAKKRL
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVRSQAPKVEKQEKKKTPKGRAKKRLQYNRRFVNVTVAPGGKRRMNQQPAGKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.39
4 0.42
5 0.45
6 0.54
7 0.58
8 0.63
9 0.64
10 0.67
11 0.73
12 0.76
13 0.79
14 0.78
15 0.8
16 0.8
17 0.84
18 0.85
19 0.86
20 0.87
21 0.88
22 0.88
23 0.89
24 0.9
25 0.89
26 0.88
27 0.87
28 0.85
29 0.79
30 0.72
31 0.62
32 0.6
33 0.51
34 0.43
35 0.37
36 0.3
37 0.26
38 0.28
39 0.32
40 0.26
41 0.27
42 0.31
43 0.39
44 0.45
45 0.52
46 0.58