Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9I4T9

Protein Details
Accession A0A1B9I4T9   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
309-334GEFVKLKQTWQQKKRQNYREREDEIIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 12, nucl 10.5, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR026992  DIOX_N  
IPR044861  IPNS-like_FE2OG_OXY  
IPR027443  IPNS-like_sf  
Pfam View protein in Pfam  
PF03171  2OG-FeII_Oxy  
PF14226  DIOX_N  
Amino Acid Sequences MTVPTIDLSKFSTPEGKFELSQTLIEAIRTKGFFYVINYGIDQEKVDKQFSIGSNFYNLPLEEKSKYIPDLENGEYNGYRPAGRAVLSGGVKDQTEVYNIPKFDGYHDRDHPEVIKENIKEIEEFARSLHTNVLDPLHQLIALALELPEDFFTNLHKYENPSEDHLRYMMYRHFNEDQLKKLNENDGLYSLGHTDLGTLTLLFRQPVAALQIKDHKTGDWKWAKPLNGSLTVNTCDALSFLTGGYIKSTVHRVSVPPKDQNQFDRLGLLYFARPSNDLKLSTIKSPLLIREGFTQNEFEKGEFDVPTMGEFVKLKQTWQQKKRQNYREREDEIIAPGFKGKYHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.34
4 0.32
5 0.33
6 0.36
7 0.29
8 0.29
9 0.25
10 0.23
11 0.2
12 0.2
13 0.21
14 0.17
15 0.2
16 0.2
17 0.2
18 0.18
19 0.19
20 0.19
21 0.21
22 0.26
23 0.23
24 0.24
25 0.24
26 0.24
27 0.24
28 0.23
29 0.2
30 0.16
31 0.21
32 0.22
33 0.23
34 0.21
35 0.21
36 0.27
37 0.29
38 0.31
39 0.26
40 0.24
41 0.27
42 0.27
43 0.27
44 0.23
45 0.21
46 0.18
47 0.19
48 0.22
49 0.2
50 0.2
51 0.22
52 0.22
53 0.23
54 0.23
55 0.22
56 0.22
57 0.26
58 0.27
59 0.27
60 0.25
61 0.27
62 0.24
63 0.22
64 0.21
65 0.17
66 0.15
67 0.12
68 0.14
69 0.13
70 0.13
71 0.13
72 0.12
73 0.16
74 0.16
75 0.16
76 0.15
77 0.14
78 0.14
79 0.14
80 0.14
81 0.09
82 0.11
83 0.12
84 0.15
85 0.18
86 0.18
87 0.19
88 0.19
89 0.19
90 0.21
91 0.29
92 0.3
93 0.32
94 0.36
95 0.38
96 0.37
97 0.38
98 0.35
99 0.29
100 0.28
101 0.24
102 0.27
103 0.24
104 0.26
105 0.26
106 0.25
107 0.22
108 0.2
109 0.21
110 0.16
111 0.16
112 0.14
113 0.15
114 0.15
115 0.15
116 0.16
117 0.13
118 0.12
119 0.13
120 0.14
121 0.11
122 0.11
123 0.11
124 0.09
125 0.08
126 0.07
127 0.06
128 0.05
129 0.05
130 0.05
131 0.03
132 0.03
133 0.03
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.06
140 0.08
141 0.09
142 0.1
143 0.11
144 0.14
145 0.17
146 0.21
147 0.21
148 0.23
149 0.26
150 0.25
151 0.25
152 0.22
153 0.19
154 0.16
155 0.16
156 0.16
157 0.18
158 0.18
159 0.21
160 0.23
161 0.25
162 0.32
163 0.31
164 0.31
165 0.31
166 0.32
167 0.28
168 0.28
169 0.28
170 0.24
171 0.23
172 0.2
173 0.15
174 0.15
175 0.14
176 0.13
177 0.1
178 0.08
179 0.07
180 0.06
181 0.05
182 0.04
183 0.05
184 0.05
185 0.04
186 0.04
187 0.06
188 0.06
189 0.06
190 0.06
191 0.05
192 0.05
193 0.06
194 0.1
195 0.13
196 0.13
197 0.15
198 0.23
199 0.24
200 0.26
201 0.26
202 0.23
203 0.24
204 0.26
205 0.34
206 0.34
207 0.34
208 0.39
209 0.43
210 0.44
211 0.41
212 0.44
213 0.38
214 0.36
215 0.35
216 0.3
217 0.28
218 0.28
219 0.27
220 0.22
221 0.17
222 0.11
223 0.1
224 0.09
225 0.06
226 0.05
227 0.05
228 0.06
229 0.07
230 0.07
231 0.08
232 0.08
233 0.08
234 0.09
235 0.14
236 0.13
237 0.15
238 0.16
239 0.19
240 0.26
241 0.35
242 0.39
243 0.42
244 0.48
245 0.5
246 0.53
247 0.54
248 0.5
249 0.44
250 0.38
251 0.33
252 0.27
253 0.24
254 0.2
255 0.17
256 0.14
257 0.14
258 0.14
259 0.13
260 0.14
261 0.16
262 0.21
263 0.24
264 0.23
265 0.24
266 0.29
267 0.31
268 0.32
269 0.34
270 0.28
271 0.27
272 0.28
273 0.28
274 0.27
275 0.25
276 0.24
277 0.27
278 0.31
279 0.29
280 0.28
281 0.3
282 0.25
283 0.29
284 0.28
285 0.21
286 0.18
287 0.19
288 0.21
289 0.17
290 0.17
291 0.14
292 0.14
293 0.14
294 0.14
295 0.12
296 0.12
297 0.12
298 0.13
299 0.21
300 0.21
301 0.22
302 0.29
303 0.39
304 0.48
305 0.57
306 0.65
307 0.65
308 0.76
309 0.85
310 0.89
311 0.88
312 0.88
313 0.88
314 0.88
315 0.84
316 0.78
317 0.71
318 0.63
319 0.57
320 0.51
321 0.42
322 0.32
323 0.31
324 0.26