Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9I0X2

Protein Details
Accession A0A1B9I0X2    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKSPWRLSPTRKANQRKRLKQVDSVHydrophilic
74-99TTFSKHHKGYRKSQHKVPKWTRLTLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, mito_nucl 13.833, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRQSSISFGGLLWKSPWRLSPTRKANQRKRLKQVDSVIAAVAESGIITKSLEKALSLPMESEMLAKDKYTTFSKHHKGYRKSQHKVPKWTRLTLRENPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.21
5 0.22
6 0.23
7 0.28
8 0.27
9 0.35
10 0.41
11 0.49
12 0.55
13 0.62
14 0.71
15 0.77
16 0.8
17 0.83
18 0.87
19 0.86
20 0.86
21 0.87
22 0.81
23 0.78
24 0.73
25 0.69
26 0.6
27 0.51
28 0.41
29 0.3
30 0.26
31 0.18
32 0.12
33 0.05
34 0.03
35 0.02
36 0.02
37 0.03
38 0.03
39 0.03
40 0.04
41 0.05
42 0.06
43 0.05
44 0.06
45 0.09
46 0.09
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.07
54 0.08
55 0.08
56 0.08
57 0.09
58 0.1
59 0.13
60 0.16
61 0.19
62 0.22
63 0.32
64 0.4
65 0.46
66 0.53
67 0.6
68 0.63
69 0.7
70 0.76
71 0.77
72 0.76
73 0.77
74 0.81
75 0.8
76 0.85
77 0.83
78 0.83
79 0.78
80 0.8
81 0.8
82 0.78
83 0.77
84 0.75
85 0.76