Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9HZ46

Protein Details
Accession A0A1B9HZ46   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-78ESLPEPQRSRKNKNKTKGKAQSSKFHydrophilic
NLS Segment(s)
PositionSequence
62-72SRKNKNKTKGK
Subcellular Location(s) nucl 15, cyto 5.5, cyto_pero 4, mito 3, plas 2
Family & Domain DBs
Amino Acid Sequences MRELGYSVECALQDLEKMNFDLITQQKQSLYNLGNGIYGINGTYTTYQLIHMVESLPEPQRSRKNKNKTKGKAQSSKFPIVDPGYDNGNWIRVYDPRLTRPMVLGDYLVKWSNMGITAMTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.14
5 0.13
6 0.12
7 0.12
8 0.18
9 0.19
10 0.23
11 0.23
12 0.24
13 0.26
14 0.27
15 0.29
16 0.27
17 0.25
18 0.22
19 0.22
20 0.21
21 0.19
22 0.17
23 0.16
24 0.1
25 0.08
26 0.05
27 0.04
28 0.04
29 0.04
30 0.05
31 0.06
32 0.06
33 0.07
34 0.07
35 0.08
36 0.08
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.09
43 0.09
44 0.11
45 0.12
46 0.17
47 0.26
48 0.32
49 0.41
50 0.49
51 0.58
52 0.65
53 0.75
54 0.81
55 0.79
56 0.83
57 0.83
58 0.83
59 0.81
60 0.75
61 0.74
62 0.7
63 0.7
64 0.59
65 0.49
66 0.44
67 0.37
68 0.35
69 0.28
70 0.22
71 0.19
72 0.18
73 0.19
74 0.15
75 0.17
76 0.15
77 0.14
78 0.14
79 0.13
80 0.17
81 0.23
82 0.27
83 0.29
84 0.33
85 0.34
86 0.34
87 0.33
88 0.33
89 0.27
90 0.24
91 0.2
92 0.18
93 0.18
94 0.2
95 0.19
96 0.15
97 0.14
98 0.13
99 0.13
100 0.13
101 0.12