Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9I6Z5

Protein Details
Accession A0A1B9I6Z5   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
81-104LNSNLNKNKNRKGERKRKIQIYDSHydrophilic
NLS Segment(s)
PositionSequence
88-98NKNRKGERKRK
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Amino Acid Sequences MPVVTDFSSAEYWSNRFETEKSFEWLISNEDLIPFIIDNLPNQFNDLQEETLGQEEEENVLNILHFGSGTSSLGFNLQNHLNSNLNKNKNRKGERKRKIQIYDSDYVKPPLINFEIPFLLLDVLNLNSLKKNSVSKKQKWDLIIDKSTCDAISCSSNLSSSSLDDNNDDNDNDNDQINNPIERLLFNLSKITLKNSRWISISYSSNRFNDNNNNNNNNNNKLENEINLNKFGWKLIKKQMISTTYIPGGKMIKDFKSGKERIVHEPETGIWMYILDRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.21
4 0.22
5 0.26
6 0.29
7 0.31
8 0.32
9 0.32
10 0.31
11 0.3
12 0.3
13 0.27
14 0.22
15 0.2
16 0.16
17 0.15
18 0.15
19 0.13
20 0.13
21 0.09
22 0.09
23 0.11
24 0.11
25 0.12
26 0.16
27 0.18
28 0.17
29 0.2
30 0.19
31 0.17
32 0.21
33 0.22
34 0.17
35 0.16
36 0.16
37 0.14
38 0.15
39 0.15
40 0.1
41 0.08
42 0.08
43 0.09
44 0.09
45 0.09
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.05
52 0.04
53 0.04
54 0.05
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.09
61 0.1
62 0.1
63 0.12
64 0.14
65 0.15
66 0.16
67 0.19
68 0.22
69 0.22
70 0.3
71 0.35
72 0.41
73 0.47
74 0.52
75 0.58
76 0.63
77 0.71
78 0.74
79 0.76
80 0.79
81 0.82
82 0.86
83 0.86
84 0.85
85 0.82
86 0.79
87 0.76
88 0.71
89 0.68
90 0.6
91 0.54
92 0.46
93 0.41
94 0.35
95 0.27
96 0.2
97 0.17
98 0.17
99 0.15
100 0.14
101 0.15
102 0.14
103 0.14
104 0.14
105 0.1
106 0.08
107 0.07
108 0.06
109 0.05
110 0.05
111 0.06
112 0.06
113 0.06
114 0.07
115 0.07
116 0.08
117 0.09
118 0.16
119 0.2
120 0.3
121 0.4
122 0.45
123 0.55
124 0.58
125 0.61
126 0.56
127 0.56
128 0.52
129 0.49
130 0.48
131 0.38
132 0.34
133 0.31
134 0.29
135 0.23
136 0.17
137 0.11
138 0.07
139 0.08
140 0.08
141 0.09
142 0.08
143 0.09
144 0.09
145 0.1
146 0.09
147 0.09
148 0.11
149 0.11
150 0.12
151 0.13
152 0.13
153 0.13
154 0.14
155 0.13
156 0.12
157 0.12
158 0.13
159 0.12
160 0.12
161 0.1
162 0.1
163 0.13
164 0.13
165 0.12
166 0.11
167 0.11
168 0.11
169 0.11
170 0.13
171 0.14
172 0.13
173 0.14
174 0.15
175 0.15
176 0.17
177 0.18
178 0.21
179 0.23
180 0.24
181 0.31
182 0.32
183 0.34
184 0.33
185 0.33
186 0.33
187 0.31
188 0.36
189 0.34
190 0.36
191 0.38
192 0.38
193 0.4
194 0.37
195 0.36
196 0.4
197 0.44
198 0.47
199 0.51
200 0.55
201 0.53
202 0.59
203 0.58
204 0.53
205 0.48
206 0.41
207 0.34
208 0.33
209 0.33
210 0.28
211 0.31
212 0.32
213 0.31
214 0.31
215 0.31
216 0.28
217 0.26
218 0.27
219 0.28
220 0.25
221 0.3
222 0.37
223 0.46
224 0.46
225 0.51
226 0.56
227 0.51
228 0.53
229 0.49
230 0.44
231 0.4
232 0.4
233 0.34
234 0.29
235 0.28
236 0.24
237 0.27
238 0.28
239 0.26
240 0.33
241 0.35
242 0.4
243 0.48
244 0.48
245 0.48
246 0.51
247 0.53
248 0.54
249 0.6
250 0.55
251 0.46
252 0.46
253 0.41
254 0.37
255 0.33
256 0.25
257 0.16
258 0.14