Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9I2Z6

Protein Details
Accession A0A1B9I2Z6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-40NDDLKPLIKDKKKKTPPSSPSKIKTHydrophilic
NLS Segment(s)
PositionSequence
24-33KDKKKKTPPS
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MAPKREREQTPSTASNDDLKPLIKDKKKKTPPSSPSKIKTPWTVSEEKKFKEGINSVVKKYLWNEIKSDPEISRRGANGVAGHWIALYKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.37
4 0.32
5 0.26
6 0.23
7 0.21
8 0.26
9 0.33
10 0.35
11 0.44
12 0.5
13 0.6
14 0.69
15 0.78
16 0.8
17 0.82
18 0.83
19 0.84
20 0.85
21 0.83
22 0.77
23 0.73
24 0.69
25 0.62
26 0.59
27 0.53
28 0.49
29 0.45
30 0.47
31 0.43
32 0.47
33 0.49
34 0.43
35 0.4
36 0.36
37 0.32
38 0.31
39 0.3
40 0.28
41 0.33
42 0.35
43 0.34
44 0.37
45 0.36
46 0.32
47 0.32
48 0.34
49 0.3
50 0.29
51 0.31
52 0.31
53 0.36
54 0.37
55 0.38
56 0.31
57 0.3
58 0.31
59 0.3
60 0.31
61 0.26
62 0.26
63 0.24
64 0.25
65 0.21
66 0.19
67 0.21
68 0.17
69 0.16
70 0.14
71 0.15