Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9I0L6

Protein Details
Accession A0A1B9I0L6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
138-185LTNLQIKKQKEKKIQEAKNKAREKMGLRIKKRKSLKEKKKEEELKTLEHydrophilic
NLS Segment(s)
PositionSequence
144-182KKQKEKKIQEAKNKAREKMGLRIKKRKSLKEKKKEEELK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTYQPLPTSDIDSINQNQDRFSNSSNSNSIIQHETDPSYRPLRQSVQEEFNRPPPSIWKRLLLILALLIMAWLSIWLGKKGIKEKGPTIIYANRYSDEFKYRPAASPVITEYLSKNKIKIRGASLGGVGIEEKNIPLTNLQIKKQKEKKIQEAKNKAREKMGLRIKKRKSLKEKKKEEELKTLELEKRIKGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.36
4 0.31
5 0.3
6 0.29
7 0.33
8 0.31
9 0.31
10 0.3
11 0.28
12 0.33
13 0.34
14 0.35
15 0.33
16 0.3
17 0.31
18 0.26
19 0.25
20 0.22
21 0.22
22 0.22
23 0.21
24 0.23
25 0.24
26 0.26
27 0.27
28 0.27
29 0.3
30 0.32
31 0.36
32 0.4
33 0.41
34 0.45
35 0.47
36 0.49
37 0.47
38 0.5
39 0.46
40 0.41
41 0.36
42 0.36
43 0.39
44 0.43
45 0.42
46 0.38
47 0.37
48 0.39
49 0.39
50 0.29
51 0.22
52 0.15
53 0.12
54 0.09
55 0.07
56 0.04
57 0.03
58 0.03
59 0.02
60 0.02
61 0.02
62 0.04
63 0.05
64 0.05
65 0.07
66 0.09
67 0.12
68 0.17
69 0.23
70 0.25
71 0.27
72 0.28
73 0.35
74 0.34
75 0.31
76 0.3
77 0.29
78 0.28
79 0.28
80 0.27
81 0.2
82 0.2
83 0.21
84 0.2
85 0.21
86 0.18
87 0.18
88 0.21
89 0.22
90 0.23
91 0.23
92 0.23
93 0.18
94 0.19
95 0.18
96 0.16
97 0.16
98 0.14
99 0.13
100 0.18
101 0.21
102 0.2
103 0.22
104 0.24
105 0.3
106 0.32
107 0.34
108 0.33
109 0.34
110 0.35
111 0.33
112 0.29
113 0.24
114 0.21
115 0.17
116 0.13
117 0.07
118 0.06
119 0.05
120 0.05
121 0.06
122 0.06
123 0.06
124 0.06
125 0.1
126 0.18
127 0.22
128 0.27
129 0.33
130 0.37
131 0.47
132 0.55
133 0.62
134 0.63
135 0.68
136 0.75
137 0.78
138 0.84
139 0.84
140 0.87
141 0.87
142 0.87
143 0.85
144 0.76
145 0.7
146 0.67
147 0.61
148 0.59
149 0.6
150 0.59
151 0.63
152 0.7
153 0.72
154 0.76
155 0.8
156 0.81
157 0.82
158 0.84
159 0.86
160 0.87
161 0.91
162 0.9
163 0.91
164 0.9
165 0.85
166 0.85
167 0.79
168 0.73
169 0.66
170 0.64
171 0.57
172 0.54
173 0.51