Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9IDP8

Protein Details
Accession A0A1B9IDP8   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-38SSNVSTSKTKPIKKIKKEKEEYNPNNSKHydrophilic
NLS Segment(s)
PositionSequence
22-27IKKIKK
Subcellular Location(s) nucl 19, mito_nucl 13.666, cyto_nucl 11.666, mito 6
Family & Domain DBs
Amino Acid Sequences MKRSNSTSSNSSNVSTSKTKPIKKIKKEKEEYNPNNSKLPSFDNIKVNSNWTNEKKLKCLEIIWDIGYKNMNWDLLCKETNLTEKQLKNQLSNGRVNLRKTVLEMFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.29
4 0.35
5 0.41
6 0.46
7 0.53
8 0.63
9 0.69
10 0.75
11 0.83
12 0.83
13 0.86
14 0.89
15 0.88
16 0.87
17 0.88
18 0.83
19 0.82
20 0.79
21 0.7
22 0.66
23 0.57
24 0.47
25 0.38
26 0.35
27 0.29
28 0.26
29 0.29
30 0.3
31 0.32
32 0.34
33 0.32
34 0.32
35 0.32
36 0.29
37 0.31
38 0.28
39 0.33
40 0.35
41 0.36
42 0.36
43 0.35
44 0.34
45 0.28
46 0.27
47 0.22
48 0.21
49 0.21
50 0.18
51 0.18
52 0.17
53 0.17
54 0.17
55 0.13
56 0.12
57 0.12
58 0.12
59 0.1
60 0.13
61 0.14
62 0.17
63 0.18
64 0.16
65 0.16
66 0.17
67 0.22
68 0.23
69 0.26
70 0.3
71 0.31
72 0.37
73 0.45
74 0.45
75 0.42
76 0.46
77 0.49
78 0.47
79 0.51
80 0.49
81 0.5
82 0.53
83 0.53
84 0.52
85 0.47
86 0.42
87 0.4