Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9I7A1

Protein Details
Accession A0A1B9I7A1    Localization Confidence High Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
175-208GKEYKEERRARKKAEKEDRRSKRHDKRDRSPLSDBasic
274-293RDRSRSRDRYRDERDRHRDRBasic
NLS Segment(s)
PositionSequence
163-204RKQLKAAKKEKSGKEYKEERRARKKAEKEDRRSKRHDKRDRS
225-280DRDDRRRREYERNRSRSVSPKRERDEKDYGRSERRYRDDSPRQSRNRDDRDRSRSR
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019339  CIR_N_dom  
IPR022209  CWC25  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF10197  Cir_N  
PF12542  CWC25  
Amino Acid Sequences MGGGDLNMKKSWHPVLLVNQERVWKAEKSANEEKKMLAQLRKEREEERQLAELQRLQEASTGKKRVEKMDWMYAAPGNEGGALGGQKLGDREMEEYLLGKKRVDEVLARGDKDVGATHKDFIALQNANSARDTASKIREDPLLAIKKQEQAALAALMNRPDIRKQLKAAKKEKSGKEYKEERRARKKAEKEDRRSKRHDKRDRSPLSDYSDNRDRRHSRSSYDRDRDDRRRREYERNRSRSVSPKRERDEKDYGRSERRYRDDSPRQSRNRDDRDRSRSRDRYRDERDRHRDRDDNLIGSGSRGGSDRNGGSHRHDHRNGNGHVREREERDDPRIPPPRQYSDSSRDIKPHPSRPSALDMADRPTTSSSHSRHTPSSQSNGNHSSTNGNGQSLDEMRAARLAAMQSSATQLYDQRTKSLAERAEAERRESEKDEKMRAKYGQEQANAAFFKQQSGMNLSETLSRRGGKGLLKDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.49
4 0.54
5 0.52
6 0.5
7 0.51
8 0.49
9 0.46
10 0.4
11 0.31
12 0.29
13 0.32
14 0.34
15 0.38
16 0.48
17 0.54
18 0.55
19 0.55
20 0.51
21 0.52
22 0.55
23 0.53
24 0.48
25 0.49
26 0.53
27 0.61
28 0.66
29 0.63
30 0.6
31 0.62
32 0.65
33 0.61
34 0.56
35 0.51
36 0.49
37 0.47
38 0.48
39 0.43
40 0.34
41 0.33
42 0.28
43 0.24
44 0.25
45 0.25
46 0.28
47 0.33
48 0.36
49 0.34
50 0.4
51 0.44
52 0.47
53 0.5
54 0.52
55 0.5
56 0.55
57 0.55
58 0.49
59 0.48
60 0.43
61 0.37
62 0.29
63 0.22
64 0.13
65 0.11
66 0.1
67 0.08
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.08
75 0.08
76 0.08
77 0.09
78 0.11
79 0.12
80 0.13
81 0.12
82 0.13
83 0.17
84 0.22
85 0.21
86 0.2
87 0.2
88 0.23
89 0.24
90 0.25
91 0.23
92 0.22
93 0.31
94 0.34
95 0.34
96 0.3
97 0.29
98 0.27
99 0.25
100 0.23
101 0.16
102 0.17
103 0.18
104 0.18
105 0.18
106 0.18
107 0.18
108 0.17
109 0.22
110 0.17
111 0.16
112 0.22
113 0.23
114 0.23
115 0.23
116 0.22
117 0.16
118 0.17
119 0.21
120 0.19
121 0.24
122 0.25
123 0.26
124 0.28
125 0.29
126 0.27
127 0.26
128 0.29
129 0.3
130 0.28
131 0.3
132 0.3
133 0.33
134 0.33
135 0.32
136 0.24
137 0.19
138 0.2
139 0.18
140 0.16
141 0.13
142 0.13
143 0.12
144 0.13
145 0.12
146 0.12
147 0.12
148 0.19
149 0.21
150 0.24
151 0.28
152 0.38
153 0.44
154 0.52
155 0.59
156 0.6
157 0.65
158 0.71
159 0.72
160 0.71
161 0.73
162 0.67
163 0.68
164 0.7
165 0.69
166 0.71
167 0.73
168 0.74
169 0.77
170 0.8
171 0.79
172 0.79
173 0.79
174 0.79
175 0.82
176 0.82
177 0.81
178 0.86
179 0.87
180 0.85
181 0.85
182 0.85
183 0.84
184 0.84
185 0.85
186 0.84
187 0.83
188 0.86
189 0.84
190 0.79
191 0.73
192 0.67
193 0.62
194 0.59
195 0.51
196 0.47
197 0.49
198 0.47
199 0.44
200 0.48
201 0.45
202 0.43
203 0.51
204 0.46
205 0.42
206 0.49
207 0.56
208 0.58
209 0.6
210 0.6
211 0.57
212 0.64
213 0.7
214 0.7
215 0.7
216 0.67
217 0.69
218 0.7
219 0.76
220 0.78
221 0.78
222 0.79
223 0.77
224 0.73
225 0.68
226 0.66
227 0.65
228 0.64
229 0.64
230 0.6
231 0.62
232 0.63
233 0.7
234 0.7
235 0.67
236 0.68
237 0.62
238 0.62
239 0.6
240 0.6
241 0.57
242 0.59
243 0.57
244 0.54
245 0.53
246 0.51
247 0.49
248 0.55
249 0.58
250 0.63
251 0.67
252 0.7
253 0.7
254 0.7
255 0.74
256 0.73
257 0.73
258 0.72
259 0.71
260 0.71
261 0.75
262 0.78
263 0.76
264 0.77
265 0.76
266 0.74
267 0.76
268 0.72
269 0.73
270 0.74
271 0.78
272 0.75
273 0.77
274 0.8
275 0.8
276 0.79
277 0.75
278 0.71
279 0.63
280 0.65
281 0.57
282 0.48
283 0.39
284 0.35
285 0.28
286 0.22
287 0.21
288 0.11
289 0.09
290 0.07
291 0.08
292 0.08
293 0.11
294 0.11
295 0.13
296 0.15
297 0.16
298 0.21
299 0.29
300 0.35
301 0.41
302 0.46
303 0.47
304 0.51
305 0.59
306 0.57
307 0.57
308 0.54
309 0.51
310 0.48
311 0.49
312 0.48
313 0.42
314 0.44
315 0.41
316 0.39
317 0.41
318 0.45
319 0.42
320 0.47
321 0.53
322 0.49
323 0.52
324 0.55
325 0.56
326 0.54
327 0.57
328 0.55
329 0.52
330 0.59
331 0.56
332 0.51
333 0.49
334 0.47
335 0.52
336 0.53
337 0.55
338 0.53
339 0.54
340 0.55
341 0.53
342 0.57
343 0.5
344 0.43
345 0.39
346 0.33
347 0.32
348 0.32
349 0.28
350 0.23
351 0.21
352 0.2
353 0.21
354 0.27
355 0.25
356 0.29
357 0.35
358 0.38
359 0.41
360 0.44
361 0.48
362 0.45
363 0.48
364 0.49
365 0.46
366 0.49
367 0.5
368 0.47
369 0.4
370 0.36
371 0.33
372 0.27
373 0.32
374 0.26
375 0.22
376 0.2
377 0.2
378 0.22
379 0.2
380 0.21
381 0.16
382 0.15
383 0.15
384 0.16
385 0.16
386 0.12
387 0.13
388 0.12
389 0.11
390 0.12
391 0.12
392 0.11
393 0.13
394 0.14
395 0.11
396 0.11
397 0.14
398 0.18
399 0.25
400 0.25
401 0.26
402 0.27
403 0.28
404 0.31
405 0.36
406 0.33
407 0.29
408 0.33
409 0.36
410 0.44
411 0.44
412 0.44
413 0.43
414 0.42
415 0.45
416 0.44
417 0.45
418 0.45
419 0.5
420 0.56
421 0.57
422 0.59
423 0.61
424 0.61
425 0.6
426 0.6
427 0.62
428 0.6
429 0.55
430 0.53
431 0.48
432 0.51
433 0.45
434 0.36
435 0.33
436 0.26
437 0.25
438 0.25
439 0.25
440 0.22
441 0.27
442 0.28
443 0.24
444 0.26
445 0.24
446 0.29
447 0.3
448 0.3
449 0.3
450 0.29
451 0.28
452 0.3
453 0.34
454 0.32