Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9HZD5

Protein Details
Accession A0A1B9HZD5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-32RLYTKGRILGHKRGKRNSRPNQSLVQHydrophilic
NLS Segment(s)
PositionSequence
17-22HKRGKR
Subcellular Location(s) mito 11.5, mito_nucl 10.5, nucl 8.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MSLTTNRLYTKGRILGHKRGKRNSRPNQSLVQIEGVDSKEAARSYLGKRVAYVYKAKREINGSRVRVIWGRISRPHGNSGAAKAKFRVNLPAKVFGASVRIKVFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.65
4 0.7
5 0.71
6 0.74
7 0.8
8 0.81
9 0.86
10 0.86
11 0.86
12 0.85
13 0.8
14 0.76
15 0.69
16 0.6
17 0.51
18 0.42
19 0.31
20 0.24
21 0.22
22 0.17
23 0.13
24 0.11
25 0.1
26 0.1
27 0.1
28 0.1
29 0.08
30 0.11
31 0.13
32 0.19
33 0.22
34 0.2
35 0.2
36 0.23
37 0.24
38 0.23
39 0.29
40 0.27
41 0.31
42 0.36
43 0.36
44 0.35
45 0.38
46 0.39
47 0.4
48 0.44
49 0.39
50 0.37
51 0.37
52 0.36
53 0.32
54 0.31
55 0.3
56 0.25
57 0.27
58 0.3
59 0.36
60 0.4
61 0.4
62 0.43
63 0.37
64 0.37
65 0.34
66 0.36
67 0.38
68 0.34
69 0.33
70 0.31
71 0.34
72 0.33
73 0.33
74 0.37
75 0.34
76 0.41
77 0.44
78 0.49
79 0.46
80 0.44
81 0.43
82 0.33
83 0.34
84 0.27
85 0.27