Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZHH1

Protein Details
Accession C7ZHH1   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
198-222ATNGKGTKAKKEKKTSPAVGKTARKHydrophilic
NLS Segment(s)
PositionSequence
202-223KGTKAKKEKKTSPAVGKTARKT
Subcellular Location(s) cyto 16, cyto_nucl 12.833, nucl 7.5, mito_nucl 5.166
Family & Domain DBs
KEGG nhe:NECHADRAFT_42392  -  
Amino Acid Sequences MSDGIAPAIDKVGAPDPKAPEAEAGAPTMDTTTAPSEPAKSEDSKPGGLNVPAPKPVEVMSVPETPINNRTPAGGTPRPELNIEEEPKEPAKNEDEVAFITTGVETGSAPVTSAPKDTTMTDKPADDKPTEAATNGASKPSADDVTEAAAGEKRKLGEAAPATNGAAPAEAEKAEPEERAKKARVEDVSDEPTATETATNGKGTKAKKEKKTSPAVGKTARKTRSQGPVEAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.29
4 0.32
5 0.33
6 0.31
7 0.25
8 0.25
9 0.26
10 0.21
11 0.18
12 0.15
13 0.14
14 0.14
15 0.12
16 0.1
17 0.07
18 0.08
19 0.11
20 0.11
21 0.12
22 0.13
23 0.15
24 0.16
25 0.19
26 0.21
27 0.21
28 0.24
29 0.3
30 0.33
31 0.33
32 0.32
33 0.32
34 0.32
35 0.28
36 0.31
37 0.28
38 0.27
39 0.28
40 0.29
41 0.27
42 0.24
43 0.24
44 0.22
45 0.17
46 0.18
47 0.19
48 0.19
49 0.19
50 0.2
51 0.2
52 0.19
53 0.23
54 0.21
55 0.18
56 0.17
57 0.17
58 0.17
59 0.19
60 0.25
61 0.25
62 0.25
63 0.27
64 0.28
65 0.28
66 0.28
67 0.26
68 0.23
69 0.26
70 0.25
71 0.25
72 0.24
73 0.25
74 0.25
75 0.25
76 0.2
77 0.16
78 0.17
79 0.16
80 0.16
81 0.15
82 0.14
83 0.14
84 0.15
85 0.12
86 0.09
87 0.08
88 0.07
89 0.06
90 0.05
91 0.05
92 0.03
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.06
99 0.06
100 0.07
101 0.07
102 0.08
103 0.09
104 0.1
105 0.14
106 0.15
107 0.18
108 0.18
109 0.18
110 0.2
111 0.23
112 0.25
113 0.2
114 0.19
115 0.17
116 0.19
117 0.19
118 0.16
119 0.13
120 0.11
121 0.15
122 0.14
123 0.13
124 0.1
125 0.1
126 0.11
127 0.12
128 0.12
129 0.08
130 0.09
131 0.09
132 0.1
133 0.1
134 0.09
135 0.08
136 0.1
137 0.1
138 0.1
139 0.11
140 0.1
141 0.11
142 0.11
143 0.11
144 0.15
145 0.17
146 0.19
147 0.19
148 0.19
149 0.18
150 0.18
151 0.18
152 0.12
153 0.09
154 0.07
155 0.06
156 0.07
157 0.07
158 0.07
159 0.07
160 0.1
161 0.11
162 0.12
163 0.15
164 0.21
165 0.24
166 0.29
167 0.31
168 0.32
169 0.35
170 0.41
171 0.41
172 0.4
173 0.42
174 0.42
175 0.44
176 0.4
177 0.36
178 0.29
179 0.27
180 0.21
181 0.17
182 0.11
183 0.07
184 0.11
185 0.13
186 0.15
187 0.14
188 0.17
189 0.22
190 0.24
191 0.35
192 0.41
193 0.49
194 0.57
195 0.67
196 0.74
197 0.78
198 0.86
199 0.85
200 0.85
201 0.84
202 0.82
203 0.81
204 0.8
205 0.79
206 0.78
207 0.73
208 0.68
209 0.65
210 0.65
211 0.67
212 0.63