Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9I8X7

Protein Details
Accession A0A1B9I8X7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-125GVLPKIHPELRKKKKRPSQNATNASTGHydrophilic
NLS Segment(s)
PositionSequence
107-115ELRKKKKRP
Subcellular Location(s) mito 20.5, cyto_mito 11.666, nucl 5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR002119  Histone_H2A  
IPR007125  Histone_H2A/H2B/H3  
IPR032454  Histone_H2A_C  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PF16211  Histone_H2A_C  
Amino Acid Sequences MEQKGCGTKKSIKSGLTFPVTRVRKYLVRGRYAHTIQWSAAICMAAVLEYLTAELLEVAGDTTHDHKKKTISPRYIQLAIQTDKELGDLLPKVVIAQGGVLPKIHPELRKKKKRPSQNATNASTGFEESGPGKRSFISISISISK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.55
4 0.48
5 0.41
6 0.44
7 0.44
8 0.41
9 0.39
10 0.36
11 0.34
12 0.39
13 0.45
14 0.43
15 0.48
16 0.49
17 0.51
18 0.55
19 0.52
20 0.5
21 0.45
22 0.39
23 0.31
24 0.33
25 0.29
26 0.21
27 0.2
28 0.17
29 0.13
30 0.11
31 0.1
32 0.05
33 0.05
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.03
49 0.07
50 0.13
51 0.15
52 0.16
53 0.18
54 0.21
55 0.28
56 0.38
57 0.44
58 0.44
59 0.46
60 0.51
61 0.54
62 0.52
63 0.45
64 0.38
65 0.35
66 0.29
67 0.27
68 0.22
69 0.18
70 0.16
71 0.16
72 0.12
73 0.07
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.04
83 0.05
84 0.07
85 0.07
86 0.08
87 0.08
88 0.08
89 0.09
90 0.12
91 0.15
92 0.18
93 0.27
94 0.38
95 0.49
96 0.6
97 0.68
98 0.75
99 0.82
100 0.88
101 0.89
102 0.88
103 0.88
104 0.88
105 0.88
106 0.81
107 0.76
108 0.65
109 0.56
110 0.47
111 0.36
112 0.26
113 0.17
114 0.15
115 0.13
116 0.19
117 0.21
118 0.21
119 0.21
120 0.21
121 0.22
122 0.23
123 0.24
124 0.22
125 0.2