Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R2Y6

Protein Details
Accession C4R2Y6   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
59-80ILERKEKTKKFELRRKQLEEEKBasic
NLS Segment(s)
PositionSequence
62-73RKEKTKKFELRR
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
KEGG ppa:PAS_chr2-2_0456  -  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHPQLDSERFHPCEDLIKALQECHRNEFMKQIFGLCNEPKTLLTKCLHDTRLAQEREKILERKEKTKKFELRRKQLEEEKYGKDGYLKKVIEKELELEANNGQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.25
4 0.28
5 0.27
6 0.29
7 0.33
8 0.33
9 0.33
10 0.34
11 0.39
12 0.35
13 0.35
14 0.41
15 0.38
16 0.34
17 0.32
18 0.29
19 0.23
20 0.24
21 0.28
22 0.21
23 0.2
24 0.18
25 0.18
26 0.17
27 0.19
28 0.18
29 0.19
30 0.19
31 0.21
32 0.24
33 0.28
34 0.28
35 0.26
36 0.27
37 0.26
38 0.34
39 0.33
40 0.3
41 0.27
42 0.28
43 0.3
44 0.32
45 0.29
46 0.24
47 0.32
48 0.34
49 0.41
50 0.49
51 0.53
52 0.55
53 0.62
54 0.68
55 0.7
56 0.78
57 0.79
58 0.79
59 0.82
60 0.83
61 0.81
62 0.79
63 0.75
64 0.72
65 0.67
66 0.6
67 0.53
68 0.46
69 0.39
70 0.37
71 0.36
72 0.34
73 0.38
74 0.35
75 0.36
76 0.42
77 0.45
78 0.42
79 0.38
80 0.35
81 0.31
82 0.33
83 0.3
84 0.26