Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9I327

Protein Details
Accession A0A1B9I327   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-42STQPKKVKSEKQPSSTRKKQPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MPIKRENPIEDSNSEDSRLILSTQPKKVKSEKQPSSTRKKQPWTDFEEKQFKEAIHNIVKKGIWSEIKMNFPDLSKRGADGVSNHWAAMYKKMQKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.29
3 0.24
4 0.2
5 0.2
6 0.15
7 0.14
8 0.22
9 0.28
10 0.36
11 0.42
12 0.43
13 0.47
14 0.53
15 0.59
16 0.61
17 0.65
18 0.65
19 0.67
20 0.75
21 0.78
22 0.81
23 0.81
24 0.79
25 0.76
26 0.76
27 0.76
28 0.75
29 0.74
30 0.72
31 0.7
32 0.64
33 0.63
34 0.64
35 0.56
36 0.49
37 0.43
38 0.34
39 0.3
40 0.29
41 0.28
42 0.26
43 0.29
44 0.28
45 0.29
46 0.29
47 0.26
48 0.25
49 0.24
50 0.18
51 0.18
52 0.23
53 0.25
54 0.29
55 0.3
56 0.31
57 0.27
58 0.26
59 0.29
60 0.25
61 0.24
62 0.21
63 0.21
64 0.2
65 0.2
66 0.21
67 0.18
68 0.22
69 0.25
70 0.25
71 0.23
72 0.22
73 0.25
74 0.24
75 0.29
76 0.32