Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9I8L2

Protein Details
Accession A0A1B9I8L2   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPMHKLRLRKKKDRVQVEAVNQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto_nucl 7, nucl 6, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005493  RraA/RraA-like  
IPR036704  RraA/RraA-like_sf  
Pfam View protein in Pfam  
PF03737  RraA-like  
Amino Acid Sequences MPMHKLRLRKKKDRVQVEAVNQVINIGGIRVQPRDIIIADSNGFVIVPRARAEEVAKVAKRIEESEDKIREMIENGLTLGEARSNSGYYLLTKKTIIMKDRFLDAFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.81
4 0.76
5 0.72
6 0.63
7 0.53
8 0.43
9 0.35
10 0.25
11 0.17
12 0.12
13 0.05
14 0.05
15 0.07
16 0.09
17 0.09
18 0.1
19 0.1
20 0.11
21 0.12
22 0.12
23 0.13
24 0.12
25 0.12
26 0.12
27 0.12
28 0.11
29 0.09
30 0.09
31 0.06
32 0.07
33 0.06
34 0.07
35 0.07
36 0.09
37 0.09
38 0.1
39 0.11
40 0.12
41 0.14
42 0.18
43 0.18
44 0.17
45 0.18
46 0.18
47 0.18
48 0.16
49 0.18
50 0.18
51 0.22
52 0.3
53 0.31
54 0.31
55 0.3
56 0.29
57 0.25
58 0.21
59 0.19
60 0.12
61 0.1
62 0.1
63 0.09
64 0.09
65 0.09
66 0.08
67 0.07
68 0.06
69 0.07
70 0.08
71 0.09
72 0.09
73 0.1
74 0.11
75 0.12
76 0.18
77 0.18
78 0.19
79 0.19
80 0.22
81 0.28
82 0.34
83 0.38
84 0.38
85 0.43
86 0.44
87 0.49